Comparing H281DRAFT_00016 FitnessBrowser__Burk376:H281DRAFT_00016 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2x41A Structure of beta-glucosidase 3b from thermotoga neapolitana in complex with glucose (see paper)
33% identity, 85% coverage: 97:741/763 of query aligns to 45:712/715 of 2x41A
2x42A Structure of beta-glucosidase 3b from thermotoga neapolitana in complex with alpha-d-glucose (see paper)
33% identity, 85% coverage: 97:741/763 of query aligns to 45:712/715 of 2x42A
4i3gB Crystal structure of desr, a beta-glucosidase from streptomyces venezuelae in complex with d-glucose. (see paper)
33% identity, 89% coverage: 57:736/763 of query aligns to 4:779/780 of 4i3gB
4i8dA Crystal structure of beta-d-glucoside glucohydrolase from trichoderma reesei (see paper)
33% identity, 83% coverage: 100:736/763 of query aligns to 50:710/711 of 4i8dA
Sites not aligning to the query:
4i8dB Crystal structure of beta-d-glucoside glucohydrolase from trichoderma reesei (see paper)
33% identity, 83% coverage: 100:736/763 of query aligns to 53:713/714 of 4i8dB
Sites not aligning to the query:
5wabA Crystal structure of bifidobacterium adolescentis gh3 beta-glucosidase (see paper)
33% identity, 85% coverage: 87:737/763 of query aligns to 18:646/674 of 5wabA
6jxgA Crystasl structure of beta-glucosidase d2-bgl from chaetomella raphigera (see paper)
34% identity, 86% coverage: 85:737/763 of query aligns to 38:713/713 of 6jxgA
4iigA Crystal structure of beta-glucosidase 1 from aspergillus aculeatus in complex with d-glucose (see paper)
34% identity, 76% coverage: 46:625/763 of query aligns to 11:643/834 of 4iigA
Sites not aligning to the query:
4iieA Crystal structure of beta-glucosidase 1 from aspergillus aculeatus in complex with calystegine b(2) (see paper)
34% identity, 76% coverage: 46:625/763 of query aligns to 11:643/834 of 4iieA
Sites not aligning to the query:
4iidA Crystal structure of beta-glucosidase 1 from aspergillus aculeatus in complex with 1-deoxynojirimycin (see paper)
34% identity, 76% coverage: 46:625/763 of query aligns to 11:643/834 of 4iidA
Sites not aligning to the query:
4iibA Crystal structure of beta-glucosidase 1 from aspergillus aculeatus (see paper)
34% identity, 76% coverage: 46:625/763 of query aligns to 11:643/834 of 4iibA
Sites not aligning to the query:
4iihA Crystal structure of beta-glucosidase 1 from aspergillus aculeatus in complex with thiocellobiose (see paper)
34% identity, 76% coverage: 46:625/763 of query aligns to 11:643/833 of 4iihA
Sites not aligning to the query:
4iifA Crystal structure of beta-glucosidase 1 from aspergillus aculeatus in complex with castanospermine (see paper)
34% identity, 76% coverage: 46:625/763 of query aligns to 11:643/833 of 4iifA
Sites not aligning to the query:
4iicA Crystal structure of beta-glucosidase 1 from aspergillus aculeatus in complex with isofagomine (see paper)
34% identity, 76% coverage: 46:625/763 of query aligns to 11:643/833 of 4iicA
Sites not aligning to the query:
5fjjA Three-dimensional structures of two heavily n-glycosylated aspergillus sp. Family gh3 beta-d-glucosidases (see paper)
33% identity, 75% coverage: 56:627/763 of query aligns to 24:645/839 of 5fjjA
Sites not aligning to the query:
5ju6A Structural and functional studies of glycoside hydrolase family 3 beta-glucosidase cel3a from the moderately thermophilic fungus rasamsonia emersonii (see paper)
33% identity, 75% coverage: 56:627/763 of query aligns to 25:641/835 of 5ju6A
Sites not aligning to the query:
5fjiA Three-dimensional structures of two heavily n-glycosylated aspergillus sp. Family gh3 beta-d-glucosidases (see paper)
32% identity, 75% coverage: 55:625/763 of query aligns to 24:645/840 of 5fjiA
Sites not aligning to the query:
6sz6A Chaetomium thermophilum beta-glucosidase (see paper)
31% identity, 85% coverage: 46:693/763 of query aligns to 11:686/836 of 6sz6A
Sites not aligning to the query:
6jbsA Bifunctional xylosidase/glucosidase lxyl (see paper)
28% identity, 91% coverage: 38:735/763 of query aligns to 9:760/762 of 6jbsA
6jbsC Bifunctional xylosidase/glucosidase lxyl (see paper)
28% identity, 91% coverage: 38:735/763 of query aligns to 8:759/761 of 6jbsC
>H281DRAFT_00016 FitnessBrowser__Burk376:H281DRAFT_00016
MSNLKASPHLRGIPHRAIRIACESAVSVAALVSLSAGAPQAASGPPWMNTALAPEQRAAL
LVGAMALDQKAAQLHGQSGTIAEVPACGNSIRHIPGIPALSIPTFRITNGPVGIGAGDCV
PQDRATALPMSMALAASFDPTLARAYGDVLGREARMLGLHVVEAPGMNAVRVGQGGRNFE
YLSEDPVLAGVIAENEIRGAQATGVIAMAKHFILNEQEANRNTVSVVVDDRTLHEIYLLP
FGVSVRRGNVASVMCSYNRIGSTYACETPRALNAILRGELGFMGYVQSDFGATHSTAPAL
NAGLDLEMQSGIWFTPPNLNAALATGQLTMATVNQALTRRYTQMFKAGIFDRPVARTPLD
STTIQNDGTEARVIGEQSAVLLKNSGNLLPLSGAVKSITIVGHNTYVDDAIAGGSGSSRV
VPTYTVGPQQGITNVLRQLGSSATVKTLAAPNDGSMDAAVAAAAATADVAIVMAGVVTGE
GSDRPDLSLPKGQDKLIAAVANRNERTIVVLKDGDPVLMPWVDQVPAILETWYSGQEDGN
VVARLLFGLANPSGKLPVTYPRLATDTPTSMPDRYPGTSGSDPVVQYSEGLLVGYRWYDT
RQVKPLFAFGHGLSYTSFKISDVQVSPRGYTGNGPILVALTVENTGLREGAEVAQVYLGL
PPNLGEPTKRLIAFQKVLLKPGEKRALSMYIYPINGFHALSYWDNAAQSWKIAAGTYTVY
VGNASDNIVAQSTFTVNVAMRDTGDGDDNVSRDPAPFGWDWAR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory