SitesBLAST
Comparing H281DRAFT_00233 FitnessBrowser__Burk376:H281DRAFT_00233 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
45% identity, 44% coverage: 38:235/448 of query aligns to 34:237/382 of 7ahhC
Sites not aligning to the query:
- binding (2R,3R,3aS,5R,7aR,9R,10R,10aS,12R,14aR)-2,9-bis(6-amino-9H-purin-9-yl)octahydro-2H,7H-difuro[3,2-d:3',2'-j][1,3,7,9,2,8]tetraoxadiphosphacyclododecine-3,5,10,12-tetrol 5,12-dioxide: 275, 297, 298
- binding phosphoaminophosphonic acid-adenylate ester: 12
7aheC Opua inhibited inward facing (see paper)
45% identity, 44% coverage: 38:235/448 of query aligns to 34:237/382 of 7aheC
Sites not aligning to the query:
- binding (2R,3R,3aS,5R,7aR,9R,10R,10aS,12R,14aR)-2,9-bis(6-amino-9H-purin-9-yl)octahydro-2H,7H-difuro[3,2-d:3',2'-j][1,3,7,9,2,8]tetraoxadiphosphacyclododecine-3,5,10,12-tetrol 5,12-dioxide: 275, 297, 298
7ahdC Opua (e190q) occluded (see paper)
45% identity, 44% coverage: 38:235/448 of query aligns to 34:237/260 of 7ahdC
- binding adenosine-5'-triphosphate: T39 (≠ L43), S61 (= S65), G62 (= G66), G64 (= G68), K65 (= K69), S66 (= S70), T67 (= T71), Q111 (= Q106), K161 (≠ R156), Q162 (≠ E157), S164 (= S159), G166 (= G161), M167 (= M162), Q188 (≠ E183), H221 (= H219)
Sites not aligning to the query:
1oxvD Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
39% identity, 46% coverage: 29:234/448 of query aligns to 6:214/353 of 1oxvD
1oxvA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
39% identity, 46% coverage: 29:234/448 of query aligns to 6:214/353 of 1oxvA
1oxuA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
39% identity, 46% coverage: 29:234/448 of query aligns to 6:214/353 of 1oxuA
Q97UY8 Glucose import ATP-binding protein GlcV; EC 7.5.2.- from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
39% identity, 46% coverage: 29:234/448 of query aligns to 6:214/353 of Q97UY8
- S142 (= S159) mutation to A: Decrease in ATPase activity. Can form dimers.
- G144 (= G161) mutation to A: Loss of ATPase activity. Cannot form dimers. Forms an active heterodimer; when associated with A-166.
- E166 (= E183) mutation to A: Loss of ATPase activity. Can form dimers in the presence of ATP-Mg(2+). Forms an active heterodimer; when associated with A-144.; mutation to Q: Strong decrease in ATPase activity. Can form dimers in the presence of ATP alone, without Mg(2+).
2awnB Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
32% identity, 76% coverage: 34:373/448 of query aligns to 6:356/374 of 2awnB
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
32% identity, 76% coverage: 34:373/448 of query aligns to 6:356/371 of 3puyA
- binding phosphoaminophosphonic acid-adenylate ester: W12 (≠ Q40), S37 (= S65), G38 (= G66), C39 (≠ S67), G40 (= G68), K41 (= K69), S42 (= S70), T43 (= T71), Q81 (= Q106), R128 (≠ A153), A132 (≠ E157), S134 (= S159), G136 (= G161), Q137 (≠ M162), E158 (= E183), H191 (= H219)
- binding magnesium ion: S42 (= S70), Q81 (= Q106)
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
32% identity, 76% coverage: 34:373/448 of query aligns to 6:356/371 of 3puxA
- binding adenosine-5'-diphosphate: W12 (≠ Q40), G38 (= G66), C39 (≠ S67), G40 (= G68), K41 (= K69), S42 (= S70), T43 (= T71), R128 (≠ A153), S134 (= S159), Q137 (≠ M162)
- binding beryllium trifluoride ion: S37 (= S65), G38 (= G66), K41 (= K69), Q81 (= Q106), S134 (= S159), G136 (= G161), H191 (= H219)
- binding magnesium ion: S42 (= S70), Q81 (= Q106)
3puwA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4 (see paper)
32% identity, 76% coverage: 34:373/448 of query aligns to 6:356/371 of 3puwA
- binding adenosine-5'-diphosphate: W12 (≠ Q40), V17 (= V45), G38 (= G66), C39 (≠ S67), G40 (= G68), K41 (= K69), S42 (= S70), T43 (= T71), R128 (≠ A153), A132 (≠ E157), S134 (= S159), Q137 (≠ M162)
- binding tetrafluoroaluminate ion: S37 (= S65), G38 (= G66), K41 (= K69), Q81 (= Q106), S134 (= S159), G135 (= G160), G136 (= G161), E158 (= E183), H191 (= H219)
- binding magnesium ion: S42 (= S70), Q81 (= Q106)
3puvA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4 (see paper)
32% identity, 76% coverage: 34:373/448 of query aligns to 6:356/371 of 3puvA
- binding adenosine-5'-diphosphate: W12 (≠ Q40), V17 (= V45), G38 (= G66), C39 (≠ S67), G40 (= G68), K41 (= K69), S42 (= S70), T43 (= T71), R128 (≠ A153), A132 (≠ E157), S134 (= S159), Q137 (≠ M162)
- binding magnesium ion: S42 (= S70), Q81 (= Q106)
P68187 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Escherichia coli (strain K12) (see 5 papers)
32% identity, 76% coverage: 34:373/448 of query aligns to 7:357/371 of P68187
- A85 (= A109) mutation to M: Suppressor of EAA loop mutations in MalFG.
- K106 (≠ A130) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V114 (≠ A138) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V117 (≠ A141) mutation to M: Suppressor of EAA loop mutations in MalFG.
- E119 (≠ D143) mutation to K: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- A124 (≠ D148) mutation to T: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G137 (= G161) mutation to A: Loss of maltose transport. Has greater ability to decrease mal gene expression than wild-type MalK.
- D158 (= D182) mutation to N: Loss of maltose transport but retains ability to repress mal genes.
- R228 (= R255) mutation to C: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- F241 (≠ E266) mutation to I: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- W267 (= W289) mutation to G: Normal maltose transport but constitutive mal gene expression.
- G278 (= G300) mutation to P: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- S282 (≠ T304) mutation to L: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G284 (≠ A306) mutation to S: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G302 (vs. gap) mutation to D: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- E308 (≠ R321) mutation to Q: Maltose transport is affected but retains ability to interact with MalT.
- S322 (≠ E335) mutation to F: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G340 (≠ A356) mutation to A: Maltose transport is affected but retains ability to interact with MalT.
- G346 (≠ F362) mutation to S: Normal maltose transport but constitutive mal gene expression.
- F355 (= F371) mutation to Y: Maltose transport is affected but retains ability to interact with MalT.
1q12A Crystal structure of the atp-bound e. Coli malk (see paper)
32% identity, 76% coverage: 34:373/448 of query aligns to 4:354/367 of 1q12A
- binding adenosine-5'-triphosphate: W10 (≠ Q40), S35 (= S65), G36 (= G66), C37 (≠ S67), G38 (= G68), K39 (= K69), S40 (= S70), T41 (= T71), R126 (≠ A153), A130 (≠ E157), S132 (= S159), G134 (= G161), Q135 (≠ M162)
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
37% identity, 47% coverage: 24:233/448 of query aligns to 1:215/226 of 5xu1B
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
39% identity, 44% coverage: 38:236/448 of query aligns to 14:218/375 of 2d62A
1g291 Malk (see paper)
37% identity, 52% coverage: 27:260/448 of query aligns to 4:239/372 of 1g291
- binding magnesium ion: D69 (≠ G96), E71 (≠ A98), K72 (= K99), K79 (vs. gap), D80 (vs. gap)
- binding pyrophosphate 2-: S38 (= S65), G39 (= G66), C40 (≠ S67), G41 (= G68), K42 (= K69), T43 (≠ S70), T44 (= T71)
Sites not aligning to the query:
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
32% identity, 76% coverage: 34:373/448 of query aligns to 7:355/369 of P19566
- L86 (= L110) mutation to F: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- P160 (= P184) mutation to L: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- D165 (= D189) mutation to N: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- E306 (≠ R321) mutation to K: Loss of transport. No effect on ATP-binding and ATP hydrolysis. Retains repressor activity.
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
37% identity, 54% coverage: 45:285/448 of query aligns to 32:272/378 of P69874
- F45 (≠ I58) mutation to L: Lower ATPase activity and transport efficiency.
- C54 (≠ S67) mutation to T: Loss of ATPase activity and transport.
- L60 (= L73) mutation to F: Lower ATPase activity and transport efficiency.
- L76 (≠ Y89) mutation to P: Lower ATPase activity and transport efficiency.
- V135 (≠ I145) mutation to M: Loss of ATPase activity and transport.
- D172 (= D182) mutation to N: Loss of ATPase activity and transport.
Sites not aligning to the query:
- 26 C→A: Lower ATPase activity and transport efficiency.
- 27 F→L: Lower ATPase activity and transport efficiency.
- 276 C→A: Lower ATPase activity and transport efficiency.
- 297 mutation E->K,D: Lower ATPase activity and transport efficiency.; E→Q: Loss of ATPase activity and transport.
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
38% identity, 47% coverage: 26:235/448 of query aligns to 1:219/232 of 1f3oA
Query Sequence
>H281DRAFT_00233 FitnessBrowser__Burk376:H281DRAFT_00233
MQNPKAAMTAAPIQTPPKPPRLGEEILRVKDVCRGFNKSQGELLVLDDANLSLREGEIVG
LLGRSGSGKSTLLRIIAGLIEPTDGEVTYMGKPLDGPAKGVAMVFQTFALFPWLTVLQNV
EAGLEAQGVAARERRERALAAIDLIGLDGFENAYPRELSGGMRQRVGFARALVVDPTLLL
MDEPFSALDVLTAETLRTDLLDLWTQGRMPIKAVLIVTHNIEEAVFMCDRILVLSSNPGR
VIAEIKVPFKHPRNRLDPAFRRLVDEIYAKMTARQTDEKTRKGLELHSWLPHVSTNLMAG
LIETLAAAPYHGRADMPEIARSLHLEVDDLFPVAEVLQHLGFADVREGDIFLTPPARVFA
EFGTQERKMMFAEHLLRHVPLAARIKKVLNERPGHRAPRVRFEQELEDFLSDSAAEETLD
AVINWGRYGEIFSYNDQTEIFSLEDVES
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory