SitesBLAST
Comparing H281DRAFT_00303 FitnessBrowser__Burk376:H281DRAFT_00303 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P33221 Formate-dependent phosphoribosylglycinamide formyltransferase; 5'-phosphoribosylglycinamide transformylase 2; Formate-dependent GAR transformylase; GAR transformylase 2; GART 2; GAR transformylase T; Non-folate glycinamide ribonucleotide transformylase; Phosphoribosylglycinamide formyltransferase 2; EC 6.3.1.21 from Escherichia coli (strain K12) (see 5 papers)
62% identity, 97% coverage: 7:399/407 of query aligns to 4:389/392 of P33221
- EL 22:23 (= EL 25:26) binding
- E82 (= E85) binding
- R114 (= R118) binding
- K155 (= K159) binding
- SSGKGQ 160:165 (= SSGKGQ 164:169) binding
- G162 (= G166) mutation to I: Strong decrease in the reaction rate for the conversion of formate to FGAR and in the affinity for formate. 3- and 2-fold decrease in the affinity for ATP and GAR, respectively.
- K179 (≠ Q183) modified: N6-acetyllysine
- EGVV 195:198 (≠ EGFI 199:202) binding
- E203 (= E207) binding
- E267 (= E277) binding
- E279 (= E289) binding
- D286 (= D296) binding
- K355 (= K365) binding
- RR 362:363 (= RR 372:373) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
1kjiA Crystal structure of glycinamide ribonucleotide transformylase in complex with mg-amppcp (see paper)
62% identity, 97% coverage: 7:399/407 of query aligns to 3:386/389 of 1kjiA
- active site: E114 (= E119), K154 (= K159), S159 (= S164), G161 (= G166), E264 (= E277), E276 (= E289), D283 (= D296), T284 (= T297), R360 (= R373)
- binding phosphomethylphosphonic acid adenylate ester: R113 (= R118), I152 (≠ V157), K154 (= K159), S159 (= S164), S160 (= S165), G161 (= G166), Q164 (= Q169), E192 (= E199), V195 (≠ I202), E200 (= E207), Q222 (= Q235), E264 (= E277), F266 (= F279), E276 (= E289)
- binding magnesium ion: E264 (= E277), E276 (= E289)
1ez1A Structure of escherichia coli purt-encoded glycinamide ribonucleotide transformylase complexed with mg, amppnp, and gar (see paper)
62% identity, 97% coverage: 7:399/407 of query aligns to 3:386/389 of 1ez1A
- active site: E114 (= E119), K154 (= K159), S159 (= S164), G161 (= G166), E264 (= E277), E276 (= E289), D283 (= D296), T284 (= T297), R360 (= R373)
- binding phosphoaminophosphonic acid-adenylate ester: R113 (= R118), I152 (≠ V157), K154 (= K159), S159 (= S164), S160 (= S165), G161 (= G166), E192 (= E199), V194 (≠ F201), V195 (≠ I202), F197 (= F204), E200 (= E207), Q222 (= Q235), E264 (= E277), F266 (= F279), E276 (= E289)
- binding glycinamide ribonucleotide: G20 (= G24), E21 (= E25), L22 (= L26), E81 (= E85), I82 (= I86), S160 (= S165), D283 (= D296), K352 (= K365), R359 (= R372), R360 (= R373)
- binding magnesium ion: E264 (= E277), E276 (= E289)
1eyzA Structure of escherichia coli purt-encoded glycinamide ribonucleotide transformylase complexed with mg and amppnp (see paper)
62% identity, 97% coverage: 7:399/407 of query aligns to 3:386/389 of 1eyzA
- active site: E114 (= E119), K154 (= K159), S159 (= S164), G161 (= G166), E264 (= E277), E276 (= E289), D283 (= D296), T284 (= T297), R360 (= R373)
- binding phosphoaminophosphonic acid-adenylate ester: R113 (= R118), I152 (≠ V157), K154 (= K159), S159 (= S164), S160 (= S165), G161 (= G166), Q164 (= Q169), E192 (= E199), V195 (≠ I202), F197 (= F204), E200 (= E207), E264 (= E277), F266 (= F279), E276 (= E289)
- binding magnesium ion: E264 (= E277), E276 (= E289)
1kjjA Crystal structure of glycniamide ribonucleotide transformylase in complex with mg-atp-gamma-s (see paper)
62% identity, 97% coverage: 7:399/407 of query aligns to 3:383/386 of 1kjjA
- active site: E114 (= E119), K154 (= K159), S159 (= S164), G161 (= G166), E261 (= E277), E273 (= E289), D280 (= D296), T281 (= T297), R357 (= R373)
- binding phosphothiophosphoric acid-adenylate ester: R113 (= R118), I152 (≠ V157), K154 (= K159), S159 (= S164), S160 (= S165), G161 (= G166), Q164 (= Q169), E189 (= E199), V192 (≠ I202), E197 (= E207), Q219 (= Q235), E261 (= E277), F263 (= F279), E273 (= E289)
- binding magnesium ion: E261 (= E277), E273 (= E289)
1kj8A Crystal structure of purt-encoded glycinamide ribonucleotide transformylase in complex with mg-atp and gar (see paper)
62% identity, 97% coverage: 7:399/407 of query aligns to 3:383/386 of 1kj8A
- active site: E114 (= E119), K154 (= K159), S159 (= S164), G161 (= G166), E261 (= E277), E273 (= E289), D280 (= D296), T281 (= T297), R357 (= R373)
- binding adenosine-5'-triphosphate: R113 (= R118), I152 (≠ V157), K154 (= K159), S159 (= S164), S160 (= S165), G161 (= G166), Q164 (= Q169), E189 (= E199), V192 (≠ I202), F194 (= F204), E197 (= E207), Q219 (= Q235), G222 (= G238), E261 (= E277), F263 (= F279), E273 (= E289)
- binding glycinamide ribonucleotide: G20 (= G24), E21 (= E25), L22 (= L26), E81 (= E85), I82 (= I86), S160 (= S165), D280 (= D296), K349 (= K365), R356 (= R372)
- binding magnesium ion: E261 (= E277), E273 (= E289)
1kjqA Crystal structure of glycinamide ribonucleotide transformylase in complex with mg-adp (see paper)
61% identity, 97% coverage: 7:399/407 of query aligns to 3:385/388 of 1kjqA
- active site: E114 (= E119), K154 (= K159), E263 (= E277), E275 (= E289), D282 (= D296), T283 (= T297), R359 (= R373)
- binding adenosine-5'-diphosphate: R113 (= R118), I152 (≠ V157), K154 (= K159), E191 (= E199), V193 (≠ F201), V194 (≠ I202), F196 (= F204), E199 (= E207), Q221 (= Q235), F265 (= F279), E275 (= E289)
- binding magnesium ion: E263 (= E277), E275 (= E289)
O58056 Formate-dependent phosphoribosylglycinamide formyltransferase; 5'-phosphoribosylglycinamide transformylase 2; Formate-dependent GAR transformylase; GAR transformylase 2; GART 2; Non-folate glycinamide ribonucleotide transformylase; Phosphoribosylglycinamide formyltransferase 2; EC 6.3.1.21 from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
48% identity, 98% coverage: 1:398/407 of query aligns to 2:408/430 of O58056
2dwcB Crystal structure of probable phosphoribosylglycinamide formyl transferase from pyrococcus horikoshii ot3 complexed with adp
46% identity, 98% coverage: 1:398/407 of query aligns to 4:397/409 of 2dwcB
- active site: E265 (= E277), E277 (= E289), D284 (= D296), T285 (= T297), R372 (= R373)
- binding adenosine-5'-diphosphate: R120 (= R118), H159 (≠ V157), K161 (= K159), H190 (≠ F201), I191 (= I202), F193 (= F204), E196 (= E207), F267 (= F279), E277 (= E289)
3q2oB Crystal structure of purk: n5-carboxyaminoimidazole ribonucleotide synthetase (see paper)
28% identity, 93% coverage: 16:392/407 of query aligns to 2:367/377 of 3q2oB
3v4sA Crystal structure of adp-atp complex of purk: n5-carboxyaminoimidazole ribonucleotide synthetase (see paper)
28% identity, 93% coverage: 16:392/407 of query aligns to 1:366/380 of 3v4sA
- binding adenosine-5'-diphosphate: R106 (= R118), K146 (= K159), Y152 (vs. gap), G154 (= G166), Q157 (= Q169), W183 (≠ F201), V184 (≠ I202), E189 (= E207), N215 (≠ G238), F256 (= F279), N266 (≠ S288), E267 (= E289)
- binding carbonate ion: R271 (= R293), H273 (= H295), N274 (≠ D296)
3r5hA Crystal structure of adp-air complex of purk: n5-carboxyaminoimidazole ribonucleotide synthetase (see paper)
28% identity, 93% coverage: 16:392/407 of query aligns to 2:367/383 of 3r5hA
- binding adenosine-5'-diphosphate: R107 (= R118), K147 (= K159), Q158 (= Q169), W184 (≠ F201), V185 (≠ I202), F187 (= F204), E190 (= E207), N216 (≠ G238), F257 (= F279), N267 (≠ S288), E268 (= E289)
- binding 5-aminoimidazole ribonucleotide: G17 (vs. gap), Q18 (≠ E25), L19 (= L26), E76 (= E85), Y153 (vs. gap), R272 (= R293), K340 (= K365), R347 (= R372)
3v4sB Crystal structure of adp-atp complex of purk: n5-carboxyaminoimidazole ribonucleotide synthetase (see paper)
28% identity, 93% coverage: 16:392/407 of query aligns to 3:368/381 of 3v4sB
- binding adenosine-5'-triphosphate: R108 (= R118), K148 (= K159), Y154 (vs. gap), D155 (≠ S165), G156 (= G166), Q159 (= Q169), E183 (= E199), W185 (≠ F201), V186 (≠ I202), F188 (= F204), E191 (= E207), H214 (≠ Q235), N217 (≠ G238), E256 (= E277), F258 (= F279), E269 (= E289)
- binding carbonate ion: R273 (= R293), H275 (= H295), N276 (≠ D296)
- binding magnesium ion: T105 (= T115), E111 (≠ R122), E256 (= E277), E269 (= E289), L270 (≠ V290)
4dlkA Crystal structure of atp-ca++ complex of purk: n5- carboxyaminoimidazole ribonucleotide synthetase (see paper)
28% identity, 93% coverage: 16:392/407 of query aligns to 2:367/380 of 4dlkA
- active site: Y153 (vs. gap), G155 (= G166), E255 (= E277), E268 (= E289), N275 (≠ D296), S276 (≠ T297), K348 (≠ R373)
- binding adenosine-5'-triphosphate: E76 (= E85), F77 (≠ I86), R107 (= R118), K147 (= K159), Y153 (vs. gap), D154 (≠ S165), G155 (= G166), Q158 (= Q169), W184 (≠ F201), V185 (≠ I202), F187 (= F204), E190 (= E207), E255 (= E277), F257 (= F279), N267 (≠ S288), E268 (= E289), R272 (= R293), H274 (= H295), N275 (≠ D296), K340 (= K365), R347 (= R372), K348 (≠ R373)
- binding calcium ion: E255 (= E277), E268 (= E289)
- binding phosphate ion: Q47 (= Q54), A49 (= A56)
3ax6A Crystal structure of n5-carboxyaminoimidazole ribonucleotide synthetase from thermotoga maritima
26% identity, 90% coverage: 35:402/407 of query aligns to 21:359/360 of 3ax6A
- active site: E231 (= E277), E244 (= E289), N251 (≠ D296), S252 (≠ T297), K330 (≠ R373)
- binding adenosine-5'-diphosphate: K101 (≠ R118), V136 (= V157), K138 (= K159), E164 (= E199), F166 (= F201), V167 (≠ I202), E172 (= E207), F233 (= F279), N243 (≠ S288)
4mamA The crystal structure of phosphoribosylaminoimidazole carboxylase atpase subunit of francisella tularensis subsp. Tularensis schu s4 in complex with an adp analog, amp-cp
27% identity, 76% coverage: 17:327/407 of query aligns to 2:298/373 of 4mamA
- active site: Y144 (≠ S164), G146 (= G166), E247 (= E277), E259 (= E289), N266 (≠ D296), S267 (≠ T297)
- binding phosphomethylphosphonic acid adenosyl ester: R98 (= R118), I136 (≠ V157), K138 (= K159), Y144 (≠ S164), G146 (= G166), Q149 (= Q169), E175 (= E199), F177 (= F201), V178 (≠ I202), F180 (= F204), E183 (= E207), H206 (= H233), F249 (= F279), E259 (= E289)
Sites not aligning to the query:
4ma0A The crystal structure of phosphoribosylaminoimidazole carboxylase atpase subunit of francisella tularensis subsp. Tularensis schu s4 in complex with partially hydrolysed atp
27% identity, 76% coverage: 17:327/407 of query aligns to 2:298/366 of 4ma0A
- active site: Y144 (≠ S164), G146 (= G166), E247 (= E277), E259 (= E289), N266 (≠ D296), S267 (≠ T297)
- binding adenosine monophosphate: I136 (≠ V157), K138 (= K159), E175 (= E199), A176 (≠ G200), F177 (= F201), V178 (≠ I202), E183 (= E207), H206 (= H233), F249 (= F279), E259 (= E289)
Sites not aligning to the query:
5jqwA The crystal structure of phosphoribosylaminoimidazole carboxylase atpase subunit of francisella tularensis subsp. Tularensis schu s4 in complex with adp
27% identity, 76% coverage: 17:327/407 of query aligns to 2:298/365 of 5jqwA
- active site: Y144 (≠ S164), G146 (= G166), E247 (= E277), E259 (= E289), N266 (≠ D296), S267 (≠ T297)
- binding adenosine-5'-diphosphate: R98 (= R118), K138 (= K159), G143 (≠ S163), Y144 (≠ S164), D145 (≠ S165), G146 (= G166), V178 (≠ I202), E183 (= E207), H206 (= H233), F249 (= F279), E259 (= E289)
Sites not aligning to the query:
3aw8A Crystal structure of n5-carboxyaminoimidazole ribonucleotide synthetase from thermus thermophilus hb8
30% identity, 81% coverage: 37:365/407 of query aligns to 21:322/360 of 3aw8A
- active site: E240 (= E277), E252 (= E289), N259 (≠ D296), S260 (≠ T297)
- binding adenosine monophosphate: L135 (≠ V157), K137 (= K159), Q142 (= Q169), F168 (= F201), V169 (≠ I202), E174 (= E207), H197 (≠ Q235), F242 (= F279), E252 (= E289)
Sites not aligning to the query:
3k5iA Crystal structure of n5-carboxyaminoimidazole synthase from aspergillus clavatus in complex with adp and 5-aminoimadazole ribonucleotide (see paper)
27% identity, 89% coverage: 30:390/407 of query aligns to 19:370/381 of 3k5iA
- active site: E254 (= E277), E267 (= E289), N274 (≠ D296), S275 (≠ T297), K353 (≠ R373)
- binding adenosine-5'-diphosphate: K104 (≠ R118), K146 (= K159), Y152 (≠ S164), D153 (≠ S165), G154 (= G166), W183 (≠ F201), A184 (≠ I202), F186 (= F204), E189 (= E207), Q211 (= Q235), S214 (≠ G238), E267 (= E289)
- binding 5-aminoimidazole ribonucleotide: E73 (= E85), I74 (= I86), Y152 (≠ S164), D153 (≠ S165), R155 (≠ K167), R271 (= R293), K345 (= K365), R352 (= R372)
- binding magnesium ion: E254 (= E277), E267 (= E289)
Sites not aligning to the query:
Query Sequence
>H281DRAFT_00303 FitnessBrowser__Burk376:H281DRAFT_00303
MQIGQRIGTPLSESATRVMLLGAGELGKEVIISLQRLGVEVIAVDRYPNAPGHQVAHRTH
VIDMTDGAALRALVEQERPHLIVPEIEAIATDALAAIESDGLAEVIPTARATQLTMNREG
IRRLAAEELGLPTSPYAFADSLDELRAGIAKVGYPCVVKPVMSSSGKGQSVLKSDADVEA
AWQYAMAGGRVNYGRVIVEGFIDFDYEITQLTVRAVDPSTGEVATYFCDPIGHVQVAGDY
VESWQPQPMNPLALERSREVAHKVTAALGGRGLFGVELFVRGDDVWFSEVSPRPHDTGLV
TLCSQRFSEFELHARAILGLPVDTSLRAPGASAVIYGGLDEAGIAFEGVAAALAVPNADL
RLFGKPESFVKRRMGVALATGGDIDEARSRAKEAAAAVRPVSGKSAQ
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory