SitesBLAST
Comparing H281DRAFT_00309 FitnessBrowser__Burk376:H281DRAFT_00309 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 19 hits to proteins with known functional sites (download)
P27305 Glutamyl-Q tRNA(Asp) synthetase; Glu-Q-RSs; EC 6.1.1.- from Escherichia coli (strain K12) (see paper)
46% identity, 82% coverage: 24:286/320 of query aligns to 15:265/308 of P27305
- E55 (= E64) binding
- Y182 (= Y203) binding
- R200 (= R221) binding
4a91A Crystal structure of the glutamyl-queuosine trnaasp synthetase from e. Coli complexed with l-glutamate (see paper)
46% identity, 82% coverage: 24:286/320 of query aligns to 3:251/290 of 4a91A
- active site: S11 (= S32), K229 (= K262)
- binding glutamic acid: R7 (= R28), A9 (= A30), S11 (= S32), E43 (= E64), Y170 (= Y203), R188 (= R221), L192 (= L225)
- binding zinc ion: C99 (= C120), C101 (= C122), Y113 (= Y143), C117 (= C147)
8i9iA Glutamyl-tRNA synthetase from escherichia coli bound to glutamate and zinc
35% identity, 77% coverage: 23:269/320 of query aligns to 1:247/468 of 8i9iA
P04805 Glutamate--tRNA ligase; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 from Escherichia coli (strain K12) (see 4 papers)
34% identity, 77% coverage: 23:269/320 of query aligns to 1:247/471 of P04805
- C98 (= C120) mutation to S: 10-fold decrease in activity. Strong decrease in zinc content.
- C100 (= C122) mutation to S: Loss of activity. Strong decrease in zinc content.; mutation to Y: Does not prevent zinc binding. Reduces only 2-fold the binding affinity for tRNA(Glu), but reduces more than 10-fold the affinity for glutamate in the presence of tRNA(Glu).
- C125 (= C147) mutation to S: Loss of activity. Strong decrease in zinc content.
- H127 (≠ N149) mutation to Q: 10-fold decrease in activity. Strong decrease in zinc content.
- H129 (vs. gap) mutation to Q: No change in activity or in zinc content.
- H131 (= H152) mutation to Q: No change in activity or in zinc content.
- H132 (≠ G153) mutation to Q: No change in activity or in zinc content.
- C138 (≠ W159) mutation to S: No change in activity or in zinc content.
- S239 (= S261) modified: Phosphoserine; mutation to D: Does not aminoacylate tRNA(Glu), not phosphorylated by HipA.
4g6zA Crystal structure of a glutamyl-tRNA synthetase glurs from burkholderia thailandensis bound to l-glutamate (see paper)
38% identity, 76% coverage: 26:269/320 of query aligns to 4:232/380 of 4g6zA
Q8DLI5 Glutamate--tRNA ligase; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 from Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1) (see paper)
35% identity, 77% coverage: 23:269/320 of query aligns to 1:258/485 of Q8DLI5
- R6 (= R28) binding
- Y192 (= Y203) binding
2cfoA Non-discriminating glutamyl-tRNA synthetase from thermosynechococcus elongatus in complex with glu (see paper)
35% identity, 76% coverage: 26:269/320 of query aligns to 3:257/484 of 2cfoA
6brlA Crystal structure of a glutamate tRNA ligase from elizabethkingia meningosepticum ccug26117 in complex with its amino acid
32% identity, 75% coverage: 26:265/320 of query aligns to 4:264/502 of 6brlA
4griB Crystal structure of a glutamyl-tRNA synthetase glurs from borrelia burgdorferi bound to glutamic acid and zinc (see paper)
30% identity, 88% coverage: 26:307/320 of query aligns to 3:302/485 of 4griB
- active site: S9 (= S32), K253 (= K262)
- binding glutamic acid: R5 (= R28), A7 (= A30), S9 (= S32), E41 (= E64), Y194 (= Y203), R212 (= R221), W216 (≠ L225)
- binding zinc ion: C105 (= C120), C107 (= C122), Y128 (= Y143), C132 (= C147)
2cv2A Glutamyl-tRNA synthetase from thermus thermophilus in complex with tRNA(glu) and an enzyme inhibitor, glu-ams (see paper)
32% identity, 88% coverage: 28:309/320 of query aligns to 5:294/468 of 2cv2A
- active site: K246 (= K262)
- binding o5'-(l-glutamyl-sulfamoyl)-adenosine: R5 (= R28), A7 (= A30), S9 (= S32), G17 (= G40), I21 (≠ S44), E41 (= E64), Y187 (= Y203), R205 (= R221), A206 (≠ G222), E208 (≠ D224), W209 (≠ L225), L235 (≠ V251), L236 (≠ V252)
- binding : S9 (= S32), T43 (≠ I66), D44 (= D67), R47 (= R70), V145 (≠ A158), R163 (≠ Q178), Y168 (≠ Q183), E172 (≠ D188), V177 (= V193), K180 (≠ R196), S181 (≠ A197), Y187 (= Y203), E207 (≠ A223), E208 (≠ D224), W209 (≠ L225), V211 (≠ D227), R237 (≠ T253), K241 (≠ G257), L272 (= L287), M273 (≠ N288), G274 (≠ L289), E282 (≠ A297)
Sites not aligning to the query:
- binding : 299, 303, 304, 309, 312, 319, 357, 358, 417, 432, 435, 442, 443, 444, 446, 447, 448
2cv1A Glutamyl-tRNA synthetase from thermus thermophilus in complex with tRNA(glu), atp, and an analog of l-glutamate: a quaternary complex
32% identity, 88% coverage: 28:309/320 of query aligns to 5:294/468 of 2cv1A
- active site: K246 (= K262)
- binding adenosine-5'-triphosphate: P8 (= P31), S9 (= S32), G17 (= G40), T18 (≠ S41), I21 (≠ S44), R47 (= R70), A206 (≠ G222), W209 (≠ L225), L235 (≠ V251), L236 (≠ V252)
- binding (4s)-4-amino-5-hydroxypentanoic acid: R5 (= R28), A7 (= A30), E41 (= E64), Y187 (= Y203), R205 (= R221), W209 (≠ L225)
- binding : S9 (= S32), E41 (= E64), T43 (≠ I66), D44 (= D67), R47 (= R70), V145 (≠ A158), R163 (≠ Q178), V166 (≠ Q181), E172 (≠ D188), V177 (= V193), K180 (≠ R196), S181 (≠ A197), Y187 (= Y203), E207 (≠ A223), E208 (≠ D224), W209 (≠ L225), V211 (≠ D227), R237 (≠ T253), K241 (≠ G257), K243 (= K259), M273 (≠ N288), G274 (≠ L289), S276 (= S291), E282 (≠ A297)
Sites not aligning to the query:
- binding : 299, 303, 304, 309, 312, 319, 357, 358, 417, 427, 432, 435, 442, 443, 444, 446, 447, 448
2cuzA Glutamyl-tRNA synthetase from thermus thermophilus in complex with l-glutamate (see paper)
32% identity, 88% coverage: 28:309/320 of query aligns to 5:294/468 of 2cuzA
1n78A Crystal structure of thermus thermophilus glutamyl-tRNA synthetase complexed with tRNA(glu) and glutamol-amp. (see paper)
32% identity, 88% coverage: 28:309/320 of query aligns to 5:294/468 of 1n78A
- active site: K246 (= K262)
- binding glutamol-amp: R5 (= R28), A7 (= A30), P8 (= P31), S9 (= S32), G17 (= G40), T18 (≠ S41), I21 (≠ S44), E41 (= E64), Y187 (= Y203), N191 (≠ V207), R205 (= R221), A206 (≠ G222), E208 (≠ D224), W209 (≠ L225), L235 (≠ V251), L236 (≠ V252)
- binding : S9 (= S32), T43 (≠ I66), D44 (= D67), R47 (= R70), V145 (≠ A158), R163 (≠ Q178), V166 (≠ Q181), Y168 (≠ Q183), E172 (≠ D188), V177 (= V193), K180 (≠ R196), S181 (≠ A197), Y187 (= Y203), E207 (≠ A223), E208 (≠ D224), W209 (≠ L225), L210 (≠ M226), V211 (≠ D227), R237 (≠ T253), K241 (≠ G257), M273 (≠ N288), G274 (≠ L289), E282 (≠ A297)
Sites not aligning to the query:
- binding : 297, 303, 304, 309, 312, 319, 357, 358, 417, 427, 432, 435, 442, 443, 444, 446, 447, 448
1j09A Crystal structure of thermus thermophilus glutamyl-tRNA synthetase complexed with atp and glu (see paper)
32% identity, 88% coverage: 28:309/320 of query aligns to 5:294/468 of 1j09A
- active site: K246 (= K262)
- binding adenosine-5'-triphosphate: H15 (= H38), E208 (≠ D224), L235 (≠ V251), L236 (≠ V252), K243 (= K259), I244 (≠ L260), S245 (= S261), K246 (= K262), R247 (≠ Q263)
- binding glutamic acid: R5 (= R28), A7 (= A30), S9 (= S32), E41 (= E64), Y187 (= Y203), N191 (≠ V207), R205 (= R221), W209 (≠ L225)
P27000 Glutamate--tRNA ligase; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
32% identity, 88% coverage: 28:309/320 of query aligns to 5:294/468 of P27000
Sites not aligning to the query:
- 358 R→Q: Reduces affinity for tRNA and abolishes the ability to discriminate between tRNA(Glu) and tRNA(Gln).
1g59A Glutamyl-tRNA synthetase complexed with tRNA(glu). (see paper)
32% identity, 88% coverage: 28:309/320 of query aligns to 5:294/468 of 1g59A
- binding : D44 (= D67), R45 (≠ G68), A46 (≠ P69), R47 (= R70), P109 (≠ R124), V145 (≠ A158), R163 (≠ Q178), V166 (≠ Q181), E172 (≠ D188), V177 (= V193), K180 (≠ R196), S181 (≠ A197), D182 (= D198), E207 (≠ A223), E208 (≠ D224), R237 (≠ T253), K241 (≠ G257), T242 (≠ E258), K243 (= K259), M273 (≠ N288), G274 (≠ L289), E282 (≠ A297)
Sites not aligning to the query:
- binding : 299, 300, 303, 304, 309, 312, 319, 357, 358, 417, 426, 427, 432, 435, 442, 443, 444, 445, 446, 447, 448
3al0C Crystal structure of the glutamine transamidosome from thermotoga maritima in the glutamylation state. (see paper)
30% identity, 77% coverage: 26:270/320 of query aligns to 104:343/564 of 3al0C
- active site: S110 (= S32), K335 (= K262)
- binding o5'-(l-glutamyl-sulfamoyl)-adenosine: R106 (= R28), A108 (= A30), P109 (= P31), G118 (= G40), T122 (≠ S44), E142 (= E64), Y276 (= Y203), R294 (= R221), G295 (= G222), D297 (= D224), H298 (≠ L225), L324 (≠ V251), I325 (≠ V252), L333 (= L260)
- binding : T144 (≠ I66), D145 (= D67), R148 (= R70), Y208 (≠ C122), P213 (≠ I127), K252 (≠ Q178), M255 (≠ Q181), I266 (≠ V193), K269 (≠ R196), S270 (≠ A197), Y276 (= Y203), D297 (= D224), H298 (≠ L225), L299 (≠ M226), S300 (≠ D227), N301 (≠ S228), K304 (≠ R231), R330 (≠ G257), P332 (≠ K259)
Sites not aligning to the query:
- binding : 363, 364, 365, 370, 387, 389, 391, 392, 397, 400, 407, 446, 447, 453, 457, 509, 520, 524, 527, 535, 536, 538, 539
8vc5A Crystal structure of glutamyl-tRNA synthetase glurs from pseudomonas aeruginosa (zinc bound)
30% identity, 78% coverage: 22:269/320 of query aligns to 1:261/488 of 8vc5A
3aiiA Archaeal non-discriminating glutamyl-tRNA synthetase from methanothermobacter thermautotrophicus (see paper)
27% identity, 90% coverage: 28:314/320 of query aligns to 14:290/455 of 3aiiA
Query Sequence
>H281DRAFT_00309 FitnessBrowser__Burk376:H281DRAFT_00309
MSGMSSGQQGGSRCLNGGACRLMNYRGRFAPSPTGPLHFGSLVSALASWLDARAHHGAWL
VRIEDIDGPRTVPGAAQDILATLERFGMYADEPPVWQSTRIARYQQAFEQLKAAGLVYPC
GCTRKEIADSLLHAHTRNTTLAYPGTCRNGLHGKPARAWRLRVPDDDAAVIAFEDRWQGK
QTQNLATDVGDFVLRRADDQWAYQLAVVVDDADAGITHIVRGADLMDSTARQIYLQRCLG
VPTPRYLHVPVVTNQYGEKLSKQNGASALDCDQPLEALNAAARHLGLNLDSDASVKACTT
LDDFFTTATAAWAKRMRSAI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory