SitesBLAST
Comparing H281DRAFT_00356 FitnessBrowser__Burk376:H281DRAFT_00356 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3ea4A Arabidopsis thaliana acetohydroxyacid synthase in complex with monosulfuron-ester (see paper)
44% identity, 93% coverage: 18:595/621 of query aligns to 7:576/582 of 3ea4A
- active site: Y32 (= Y43), G34 (= G45), G35 (= G46), A36 (= A47), S37 (≠ I48), E58 (= E78), T81 (= T101), F120 (= F140), Q121 (= Q141), E122 (= E142), K170 (= K190), M265 (= M292), V292 (= V319), V399 (= V423), G425 (= G449), M427 (= M451), D452 (= D476), N479 (= N503), H481 (≠ G505), L482 (≠ D506), M484 (= M508), V485 (≠ I509), W488 (= W512), H557 (≠ Q576)
- binding methyl 2-{[(4-methylpyrimidin-2-yl)carbamoyl]sulfamoyl}benzoate: D290 (= D317), R291 (= R318), W488 (= W512), S567 (≠ P586)
- binding flavin-adenine dinucleotide-n5-isobutyl ketone: R160 (= R180), G221 (= G246), G222 (= G247), G223 (= G248), T245 (= T272), L246 (= L273), M247 (= M274), L263 (= L290), G264 (= G291), M265 (= M292), H266 (= H293), G285 (= G312), R287 (= R314), D289 (= D316), R291 (= R318), D309 (= D338), I310 (= I339), G327 (= G356), D328 (= D357), V329 (≠ A358), M404 (= M428), G422 (= G446)
- binding magnesium ion: D452 (= D476), N479 (= N503), H481 (≠ G505)
- binding 2-[(2e)-3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-(1-hydroxyethylidene)-4-methyl-2,3-dihydro-1,3-thiazol-5-yl]ethyltrihydrogen diphosphate: V399 (= V423), G400 (= G424), Q401 (= Q425), H402 (= H426), M427 (= M451), G451 (= G475), D452 (= D476), G453 (= G477), S454 (= S478), N479 (= N503), H481 (≠ G505), L482 (≠ D506), G483 (= G507), M484 (= M508), V485 (≠ I509)
3e9yA Arabidopsis thaliana acetohydroxyacid synthase in complex with monosulfuron (see paper)
44% identity, 93% coverage: 18:595/621 of query aligns to 7:576/582 of 3e9yA
- active site: Y32 (= Y43), G34 (= G45), G35 (= G46), A36 (= A47), S37 (≠ I48), E58 (= E78), T81 (= T101), F120 (= F140), Q121 (= Q141), E122 (= E142), K170 (= K190), M265 (= M292), V292 (= V319), V399 (= V423), G425 (= G449), M427 (= M451), D452 (= D476), N479 (= N503), H481 (≠ G505), L482 (≠ D506), M484 (= M508), V485 (≠ I509), W488 (= W512), H557 (≠ Q576)
- binding N-[(4-methylpyrimidin-2-yl)carbamoyl]-2-nitrobenzenesulfonamide: D290 (= D317), R291 (= R318), W488 (= W512), S567 (≠ P586)
- binding flavin-adenine dinucleotide-n5-isobutyl ketone: R160 (= R180), G221 (= G246), G222 (= G247), G223 (= G248), T245 (= T272), L246 (= L273), M247 (= M274), L263 (= L290), G285 (= G312), R287 (= R314), D289 (= D316), R291 (= R318), D309 (= D338), I310 (= I339), G327 (= G356), D328 (= D357), V329 (≠ A358), M404 (= M428), G422 (= G446)
- binding magnesium ion: D452 (= D476), N479 (= N503), H481 (≠ G505)
- binding 2-[(2e)-3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-(1-hydroxyethylidene)-4-methyl-2,3-dihydro-1,3-thiazol-5-yl]ethyltrihydrogen diphosphate: V399 (= V423), G400 (= G424), Q401 (= Q425), H402 (= H426), M427 (= M451), G451 (= G475), G453 (= G477), S454 (= S478), N479 (= N503), H481 (≠ G505), L482 (≠ D506), G483 (= G507), M484 (= M508), V485 (≠ I509)
P17597 Acetolactate synthase, chloroplastic; AtALS; Acetohydroxy-acid synthase; Protein CHLORSULFURON RESISTANT 1; EC 2.2.1.6 from Arabidopsis thaliana (Mouse-ear cress) (see 8 papers)
44% identity, 93% coverage: 18:595/621 of query aligns to 93:662/670 of P17597
- A122 (= A47) mutation to V: Reduced catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
- M124 (≠ L49) mutation to E: Reduced catalytic activity. Resistant to imidazolinone herbicides and reduced sensitivity to sulfonylurea herbicides.; mutation to I: No effect on catalytic activity. Increased resistance to imidazolinone herbicides.
- E144 (= E78) binding
- S186 (= S120) binding
- P197 (= P131) mutation to S: In csr1-1/GH50; resistant to sulfonylurea but not to imidazolinone herbicides.
- R199 (≠ A133) mutation R->A,E: No effect on catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
- Q207 (= Q141) binding
- K220 (= K154) binding
- R246 (= R180) binding ; binding
- K256 (= K190) binding
- G308 (= G247) binding
- TL 331:332 (= TL 272:273) binding
- C340 (≠ A281) modified: Cysteine sulfinic acid (-SO2H)
- LGMH 349:352 (= LGMH 290:293) binding
- GVRFD 371:375 (≠ GARFD 312:316) binding
- DR 376:377 (= DR 317:318) binding
- DI 395:396 (= DI 338:339) binding
- DV 414:415 (≠ DA 357:358) binding
- QH 487:488 (= QH 425:426) binding
- GG 508:509 (≠ GS 446:447) binding
- GAM 511:513 (≠ GTM 449:451) binding
- D538 (= D476) binding
- DGS 538:540 (= DGS 476:478) binding
- N565 (= N503) binding
- NQHLGM 565:570 (≠ NRGDGM 503:508) binding
- H567 (≠ G505) binding
- W574 (= W512) binding ; mutation to L: Increased catalytic activity. Resistant to imidazolinone and sulfonylurea herbicides.; mutation to S: Slightly decreased catalytic activity. Resistant to imidazolinone and sulfonylurea herbicides.
- S653 (≠ P586) binding ; mutation to A: No effect on catalytic activity or sensitivity to herbicides.; mutation to F: No effect on catalytic activity. Resistant to imidazolinone herbicides and also slightly sulfonylurea-resistant.; mutation to N: In csr1-2/GH90; no effect on catalytic activity. Resistant to imidazolinone but not to sulfonylurea herbicides.; mutation to T: No effect on catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
5k2oA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a pyrimidinyl-benzoate herbicide, pyrithiobac (see paper)
44% identity, 93% coverage: 18:595/621 of query aligns to 8:577/585 of 5k2oA
- active site: Y33 (= Y43), G35 (= G45), G36 (= G46), A37 (= A47), S38 (≠ I48), E59 (= E78), T82 (= T101), F121 (= F140), Q122 (= Q141), E123 (= E142), K171 (= K190), M266 (= M292), V293 (= V319), V400 (= V423), G426 (= G449), M428 (= M451), D453 (= D476), N480 (= N503), H482 (≠ G505), L483 (≠ D506), M485 (= M508), V486 (≠ I509), W489 (= W512), H558 (≠ Q576)
- binding 2-chloranyl-6-(4,6-dimethoxypyrimidin-2-yl)sulfanyl-benzoic acid: M266 (= M292), R292 (= R318), W489 (= W512), S568 (≠ P586)
- binding flavin-adenine dinucleotide: R161 (= R180), G222 (= G246), G223 (= G247), G224 (= G248), T246 (= T272), L247 (= L273), M248 (= M274), L264 (= L290), G286 (= G312), R288 (= R314), D290 (= D316), V293 (= V319), D310 (= D338), I311 (= I339), D329 (= D357), V330 (≠ A358), Q404 (= Q427), M405 (= M428), G423 (= G446)
- binding magnesium ion: D453 (= D476), N480 (= N503), H482 (≠ G505)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (= V423), G401 (= G424), Q402 (= Q425), H403 (= H426), M428 (= M451), D453 (= D476), G454 (= G477), S455 (= S478), N480 (= N503), H482 (≠ G505), L483 (≠ D506), G484 (= G507), M485 (= M508), V486 (≠ I509)
8et4A Crystal structure of wild-type arabidopsis thaliana acetohydroxyacid synthase in complex with amidosulfuron (see paper)
44% identity, 93% coverage: 18:595/621 of query aligns to 8:577/582 of 8et4A
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V400 (= V423), G401 (= G424), Q402 (= Q425), H403 (= H426), G426 (= G449), M428 (= M451), G452 (= G475), D453 (= D476), G454 (= G477), S455 (= S478), M458 (= M481), N480 (= N503), H482 (≠ G505), L483 (≠ D506), G484 (= G507), M485 (= M508), V486 (≠ I509)
- binding flavin-adenine dinucleotide: R161 (= R180), G222 (= G246), G223 (= G247), G224 (= G248), T246 (= T272), L247 (= L273), M248 (= M274), L264 (= L290), M266 (= M292), H267 (= H293), G286 (= G312), V287 (≠ A313), R288 (= R314), D290 (= D316), R292 (= R318), V293 (= V319), D310 (= D338), I311 (= I339), D329 (= D357), V330 (≠ A358), M405 (= M428), G423 (= G446)
- binding magnesium ion: F370 (≠ Y393), D453 (= D476), M458 (= M481), Q461 (≠ G484), N480 (= N503), H482 (≠ G505), K533 (≠ P551)
- binding N-{[(4,6-dimethoxypyrimidin-2-yl)carbamoyl]sulfamoyl}-N-methylmethanesulfonamide: M266 (= M292), R292 (= R318), M485 (= M508), W489 (= W512), S568 (≠ P586)
5wj1A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a triazolopyrimidine herbicide, penoxsulam (see paper)
44% identity, 93% coverage: 18:595/621 of query aligns to 8:577/582 of 5wj1A
- active site: Y33 (= Y43), G35 (= G45), G36 (= G46), A37 (= A47), S38 (≠ I48), E59 (= E78), T82 (= T101), F121 (= F140), Q122 (= Q141), E123 (= E142), K171 (= K190), M266 (= M292), V293 (= V319), V400 (= V423), G426 (= G449), M428 (= M451), D453 (= D476), N480 (= N503), H482 (≠ G505), L483 (≠ D506), M485 (= M508), V486 (≠ I509), W489 (= W512), H558 (≠ Q576)
- binding flavin-adenine dinucleotide: R161 (= R180), G222 (= G246), G223 (= G247), G224 (= G248), T246 (= T272), L247 (= L273), M248 (= M274), M263 (= M289), L264 (= L290), G286 (= G312), R288 (= R314), V293 (= V319), D310 (= D338), I311 (= I339), D329 (= D357), V330 (≠ A358), M405 (= M428), G423 (= G446), G424 (≠ S447)
- binding magnesium ion: D453 (= D476), N480 (= N503), H482 (≠ G505)
- binding 2-(2,2-difluoroethoxy)-N-(5,8-dimethoxy[1,2,4]triazolo[1,5-c]pyrimidin-2-yl)-6-(trifluoromethyl)benzenesulfonamide: M266 (= M292), D291 (= D317), R292 (= R318), M485 (= M508), W489 (= W512), S568 (≠ P586)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (= V423), G401 (= G424), Q402 (= Q425), H403 (= H426), M428 (= M451), D453 (= D476), G454 (= G477), S455 (= S478), M458 (= M481), N480 (= N503), H482 (≠ G505), L483 (≠ D506), G484 (= G507), M485 (= M508), V486 (≠ I509)
5k6tA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylamino-carbonyl-triazolinone herbicide, propoxycarbazone-sodium (see paper)
44% identity, 93% coverage: 18:595/621 of query aligns to 8:577/582 of 5k6tA
- active site: Y33 (= Y43), G35 (= G45), G36 (= G46), A37 (= A47), S38 (≠ I48), E59 (= E78), T82 (= T101), F121 (= F140), Q122 (= Q141), E123 (= E142), K171 (= K190), M266 (= M292), V293 (= V319), V400 (= V423), G426 (= G449), M428 (= M451), D453 (= D476), N480 (= N503), H482 (≠ G505), L483 (≠ D506), M485 (= M508), V486 (≠ I509), W489 (= W512), H558 (≠ Q576)
- binding methyl 2-[(4-methyl-5-oxidanylidene-3-propoxy-1,2,4-triazol-1-yl)carbonylsulfamoyl]benzoate: H267 (= H293), R292 (= R318), M485 (= M508), W489 (= W512), S568 (≠ P586)
- binding flavin-adenine dinucleotide: R161 (= R180), G222 (= G246), G223 (= G247), G224 (= G248), T246 (= T272), L247 (= L273), M248 (= M274), L264 (= L290), G286 (= G312), R288 (= R314), D290 (= D316), R292 (= R318), V293 (= V319), D310 (= D338), I311 (= I339), D329 (= D357), V330 (≠ A358), Q404 (= Q427), M405 (= M428), G423 (= G446)
- binding magnesium ion: D453 (= D476), N480 (= N503), H482 (≠ G505)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V400 (= V423), G401 (= G424), Q402 (= Q425), H403 (= H426), G426 (= G449), M428 (= M451), G452 (= G475), G454 (= G477), S455 (= S478), N480 (= N503), H482 (≠ G505), L483 (≠ D506), G484 (= G507)
5k6rA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylamino-carbonyl-triazolinone herbicide, thiencarbazone-methyl (see paper)
44% identity, 93% coverage: 18:595/621 of query aligns to 8:577/582 of 5k6rA
- active site: Y33 (= Y43), G35 (= G45), G36 (= G46), A37 (= A47), S38 (≠ I48), E59 (= E78), T82 (= T101), F121 (= F140), Q122 (= Q141), E123 (= E142), K171 (= K190), M266 (= M292), V293 (= V319), V400 (= V423), G426 (= G449), M428 (= M451), D453 (= D476), N480 (= N503), H482 (≠ G505), L483 (≠ D506), M485 (= M508), V486 (≠ I509), W489 (= W512), H558 (≠ Q576)
- binding methyl 4-[(3-methoxy-4-methyl-5-oxidanylidene-1,2,4-triazol-1-yl)carbonylsulfamoyl]-5-methyl-thiophene-3-carboxylate: R292 (= R318), W489 (= W512), S568 (≠ P586)
- binding flavin-adenine dinucleotide: R161 (= R180), G222 (= G246), G223 (= G247), G224 (= G248), T246 (= T272), L247 (= L273), M248 (= M274), L264 (= L290), M266 (= M292), G286 (= G312), R288 (= R314), R292 (= R318), V293 (= V319), D310 (= D338), I311 (= I339), G328 (= G356), D329 (= D357), V330 (≠ A358), M405 (= M428), G423 (= G446)
- binding magnesium ion: D453 (= D476), N480 (= N503), H482 (≠ G505)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V400 (= V423), G401 (= G424), Q402 (= Q425), H403 (= H426), G426 (= G449), M428 (= M451), D453 (= D476), G454 (= G477), S455 (= S478), M458 (= M481), N480 (= N503), H482 (≠ G505), L483 (≠ D506), G484 (= G507), M485 (= M508), V486 (≠ I509)
1z8nA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with an imidazolinone herbicide, imazaquin (see paper)
44% identity, 93% coverage: 18:595/621 of query aligns to 8:577/582 of 1z8nA
- active site: Y33 (= Y43), G35 (= G45), G36 (= G46), A37 (= A47), S38 (≠ I48), E59 (= E78), T82 (= T101), F121 (= F140), Q122 (= Q141), E123 (= E142), K171 (= K190), M266 (= M292), V293 (= V319), V400 (= V423), G426 (= G449), M428 (= M451), D453 (= D476), N480 (= N503), H482 (≠ G505), L483 (≠ D506), M485 (= M508), V486 (≠ I509), W489 (= W512), H558 (≠ Q576)
- binding 2-(4-isopropyl-4-methyl-5-oxo-4,5-dihydro-1h-imidazol-2-yl)quinoline-3-carboxylic acid: K135 (= K154), R161 (= R180), Y191 (= Y210), R194 (= R213), D291 (= D317), R292 (= R318), D312 (= D340), W489 (= W512), G569 (= G587)
- binding flavin-adenine dinucleotide: R161 (= R180), G222 (= G246), G224 (= G248), T246 (= T272), L247 (= L273), M248 (= M274), L264 (= L290), G265 (= G291), M266 (= M292), H267 (= H293), G286 (= G312), V287 (≠ A313), R288 (= R314), D290 (= D316), R292 (= R318), V293 (= V319), D310 (= D338), I311 (= I339), D329 (= D357), V330 (≠ A358), M405 (= M428), G423 (= G446), G424 (≠ S447)
- binding magnesium ion: D453 (= D476), N480 (= N503)
- binding thiamine diphosphate: V400 (= V423), G401 (= G424), Q402 (= Q425), H403 (= H426), G426 (= G449), M428 (= M451), G452 (= G475), G454 (= G477), S455 (= S478), N480 (= N503), H482 (≠ G505), L483 (≠ D506), G484 (= G507), M485 (= M508), V486 (≠ I509)
1yi1A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, tribenuron methyl (see paper)
44% identity, 93% coverage: 18:595/621 of query aligns to 8:577/582 of 1yi1A
- active site: Y33 (= Y43), G35 (= G45), G36 (= G46), A37 (= A47), S38 (≠ I48), E59 (= E78), T82 (= T101), F121 (= F140), Q122 (= Q141), E123 (= E142), K171 (= K190), M266 (= M292), V293 (= V319), V400 (= V423), G426 (= G449), M428 (= M451), D453 (= D476), N480 (= N503), H482 (≠ G505), L483 (≠ D506), M485 (= M508), V486 (≠ I509), W489 (= W512), H558 (≠ Q576)
- binding methyl 2-[4-methoxy-6-methyl-1,3,5-trazin-2-yl(methyl)carbamoylsulfamoyl]benzoate: D291 (= D317), R292 (= R318), W489 (= W512), S568 (≠ P586)
- binding flavin-adenine dinucleotide: R161 (= R180), G223 (= G247), G224 (= G248), T246 (= T272), L247 (= L273), M248 (= M274), M263 (= M289), L264 (= L290), G265 (= G291), M266 (= M292), H267 (= H293), G286 (= G312), V287 (≠ A313), R288 (= R314), D290 (= D316), V293 (= V319), D310 (= D338), I311 (= I339), D329 (= D357), V330 (≠ A358), M405 (= M428), G423 (= G446), G424 (≠ S447)
- binding magnesium ion: D453 (= D476), N480 (= N503), H482 (≠ G505)
1yi0A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, sulfometuron methyl (see paper)
44% identity, 93% coverage: 18:595/621 of query aligns to 8:577/582 of 1yi0A
- active site: Y33 (= Y43), G35 (= G45), G36 (= G46), A37 (= A47), S38 (≠ I48), E59 (= E78), T82 (= T101), F121 (= F140), Q122 (= Q141), E123 (= E142), K171 (= K190), M266 (= M292), V293 (= V319), V400 (= V423), G426 (= G449), M428 (= M451), D453 (= D476), N480 (= N503), H482 (≠ G505), L483 (≠ D506), M485 (= M508), V486 (≠ I509), W489 (= W512), H558 (≠ Q576)
- binding methyl 2-[({[(4,6-dimethylpyrimidin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: D291 (= D317), R292 (= R318), W489 (= W512), S568 (≠ P586)
- binding flavin-adenine dinucleotide: R161 (= R180), G222 (= G246), G223 (= G247), G224 (= G248), T246 (= T272), L247 (= L273), M248 (= M274), L264 (= L290), G265 (= G291), M266 (= M292), H267 (= H293), G286 (= G312), V287 (≠ A313), R288 (= R314), D290 (= D316), R292 (= R318), V293 (= V319), D310 (= D338), I311 (= I339), G328 (= G356), D329 (= D357), V330 (≠ A358), M405 (= M428), G423 (= G446), G424 (≠ S447)
- binding magnesium ion: D453 (= D476), N480 (= N503), H482 (≠ G505)
1yhzA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, chlorsulfuron (see paper)
44% identity, 93% coverage: 18:595/621 of query aligns to 8:577/582 of 1yhzA
- active site: Y33 (= Y43), G35 (= G45), G36 (= G46), A37 (= A47), S38 (≠ I48), E59 (= E78), T82 (= T101), F121 (= F140), Q122 (= Q141), E123 (= E142), K171 (= K190), M266 (= M292), V293 (= V319), V400 (= V423), G426 (= G449), M428 (= M451), D453 (= D476), N480 (= N503), H482 (≠ G505), L483 (≠ D506), M485 (= M508), V486 (≠ I509), W489 (= W512), H558 (≠ Q576)
- binding 1-(2-chlorophenylsulfonyl)-3-(4-methoxy-6-methyl-l,3,5-triazin-2-yl)urea: D291 (= D317), R292 (= R318), M485 (= M508), W489 (= W512), S568 (≠ P586)
- binding flavin-adenine dinucleotide: R161 (= R180), G223 (= G247), G224 (= G248), T246 (= T272), L247 (= L273), M248 (= M274), L264 (= L290), M266 (= M292), H267 (= H293), G286 (= G312), V287 (≠ A313), R288 (= R314), D290 (= D316), V293 (= V319), D310 (= D338), I311 (= I339), D329 (= D357), V330 (≠ A358), Q404 (= Q427), M405 (= M428), G423 (= G446), G424 (≠ S447)
- binding magnesium ion: D453 (= D476), N480 (= N503), H482 (≠ G505)
1yhyA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, metsulfuron methyl (see paper)
44% identity, 93% coverage: 18:595/621 of query aligns to 8:577/582 of 1yhyA
- active site: Y33 (= Y43), G35 (= G45), G36 (= G46), A37 (= A47), S38 (≠ I48), E59 (= E78), T82 (= T101), F121 (= F140), Q122 (= Q141), E123 (= E142), K171 (= K190), M266 (= M292), V293 (= V319), V400 (= V423), G426 (= G449), M428 (= M451), D453 (= D476), N480 (= N503), H482 (≠ G505), L483 (≠ D506), M485 (= M508), V486 (≠ I509), W489 (= W512), H558 (≠ Q576)
- binding methyl 2-[({[(4-methoxy-6-methyl-1,3,5-triazin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: D291 (= D317), R292 (= R318), V486 (≠ I509), W489 (= W512), S568 (≠ P586)
- binding flavin-adenine dinucleotide: R161 (= R180), G222 (= G246), G223 (= G247), G224 (= G248), T246 (= T272), L247 (= L273), M248 (= M274), L264 (= L290), G265 (= G291), M266 (= M292), H267 (= H293), G286 (= G312), V287 (≠ A313), R288 (= R314), D290 (= D316), V293 (= V319), D310 (= D338), I311 (= I339), D329 (= D357), V330 (≠ A358), Q404 (= Q427), M405 (= M428), G423 (= G446), G424 (≠ S447)
- binding magnesium ion: D453 (= D476), N480 (= N503), H482 (≠ G505)
1ybhA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide chlorimuron ethyl (see paper)
44% identity, 93% coverage: 18:595/621 of query aligns to 8:577/582 of 1ybhA
- active site: Y33 (= Y43), G35 (= G45), G36 (= G46), A37 (= A47), S38 (≠ I48), E59 (= E78), T82 (= T101), F121 (= F140), Q122 (= Q141), E123 (= E142), K171 (= K190), M266 (= M292), V293 (= V319), V400 (= V423), G426 (= G449), M428 (= M451), D453 (= D476), N480 (= N503), H482 (≠ G505), L483 (≠ D506), M485 (= M508), V486 (≠ I509), W489 (= W512), H558 (≠ Q576)
- binding 2-[[[[(4-chloro-6-methoxy-2-pyrimidinyl)amino]carbonyl]amino]sulfonyl]benzoic acid ethyl ester: M266 (= M292), D291 (= D317), R292 (= R318), M485 (= M508), W489 (= W512), S568 (≠ P586)
- binding flavin-adenine dinucleotide: R161 (= R180), G223 (= G247), G224 (= G248), T246 (= T272), L247 (= L273), M248 (= M274), L264 (= L290), M266 (= M292), H267 (= H293), G286 (= G312), V287 (≠ A313), R288 (= R314), D290 (= D316), V293 (= V319), D310 (= D338), I311 (= I339), D329 (= D357), V330 (≠ A358), Q404 (= Q427), M405 (= M428), G423 (= G446), G424 (≠ S447)
- binding magnesium ion: D453 (= D476), N480 (= N503), H482 (≠ G505)
5k3sA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a pyrimidinyl-benzoate herbicide, bispyribac-sodium (see paper)
44% identity, 93% coverage: 18:595/621 of query aligns to 8:577/583 of 5k3sA
- active site: Y33 (= Y43), G35 (= G45), G36 (= G46), A37 (= A47), S38 (≠ I48), E59 (= E78), T82 (= T101), F121 (= F140), Q122 (= Q141), E123 (= E142), K171 (= K190), M266 (= M292), V293 (= V319), V400 (= V423), G426 (= G449), M428 (= M451), D453 (= D476), N480 (= N503), H482 (≠ G505), L483 (≠ D506), M485 (= M508), V486 (≠ I509), W489 (= W512), H558 (≠ Q576)
- binding 2,6-bis[(4,6-dimethoxypyrimidin-2-yl)oxy]benzoic acid: R292 (= R318), M485 (= M508), W489 (= W512), G569 (= G587)
- binding flavin-adenine dinucleotide: R161 (= R180), G222 (= G246), G223 (= G247), G224 (= G248), T246 (= T272), L247 (= L273), M248 (= M274), L264 (= L290), M266 (= M292), G286 (= G312), R288 (= R314), D290 (= D316), V293 (= V319), D310 (= D338), I311 (= I339), D329 (= D357), V330 (≠ A358), M405 (= M428), G423 (= G446)
- binding magnesium ion: D453 (= D476), N480 (= N503), H482 (≠ G505)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (= V423), G401 (= G424), Q402 (= Q425), H403 (= H426), G426 (= G449), M428 (= M451), D453 (= D476), G454 (= G477), S455 (= S478), N480 (= N503), H482 (≠ G505), L483 (≠ D506), G484 (= G507), M485 (= M508), V486 (≠ I509)
1t9bB Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, chlorsulfuron (see paper)
44% identity, 92% coverage: 22:595/621 of query aligns to 8:574/595 of 1t9bB
- active site: Y29 (= Y43), G31 (= G45), G32 (= G46), A33 (= A47), I34 (= I48), E55 (= E78), T78 (= T101), F117 (= F140), Q118 (= Q141), E119 (= E142), K167 (= K190), R226 (≠ A256), M262 (= M292), V289 (= V319), V405 (= V423), L430 (≠ M448), G431 (= G449), M433 (= M451), D458 (= D476), N485 (= N503), E487 (≠ G505), Q488 (≠ D506), M490 (= M508), V491 (≠ I509), W494 (= W512), L516 (≠ A536), G521 (= G541), L522 (≠ F542), K555 (≠ Q576)
- binding 1-(2-chlorophenylsulfonyl)-3-(4-methoxy-6-methyl-l,3,5-triazin-2-yl)urea: V107 (= V130), P108 (= P131), D287 (= D317), R288 (= R318), M490 (= M508), W494 (= W512)
- binding flavin-adenine dinucleotide: R157 (= R180), G215 (= G246), A216 (≠ G247), G217 (= G248), N220 (≠ A251), T242 (= T272), L243 (= L273), Q244 (≠ M274), M259 (= M289), L260 (= L290), M262 (= M292), H263 (= H293), G282 (= G312), A283 (= A313), R284 (= R314), D286 (= D316), R288 (= R318), V289 (= V319), E315 (≠ D338), V316 (≠ I339), N320 (≠ E343), G333 (= G356), D334 (= D357), A335 (= A358), Q409 (= Q427), M410 (= M428), G428 (= G446), G429 (≠ S447)
- binding magnesium ion: D458 (= D476), N485 (= N503), E487 (≠ G505)
7tzzA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase p197t mutant in complex with bispyribac-sodium (see paper)
44% identity, 93% coverage: 18:595/621 of query aligns to 8:577/582 of 7tzzA
- binding 2,6-bis[(4,6-dimethoxypyrimidin-2-yl)oxy]benzoic acid: M266 (= M292), R292 (= R318), W489 (= W512), S568 (≠ P586)
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V400 (= V423), G401 (= G424), Q402 (= Q425), H403 (= H426), G426 (= G449), M428 (= M451), G452 (= G475), D453 (= D476), G454 (= G477), S455 (= S478), L483 (≠ D506), G484 (= G507), M485 (= M508), V486 (≠ I509)
- binding flavin-adenine dinucleotide: R161 (= R180), G222 (= G246), G223 (= G247), G224 (= G248), T246 (= T272), L247 (= L273), M248 (= M274), M263 (= M289), L264 (= L290), M266 (= M292), H267 (= H293), G286 (= G312), R288 (= R314), V293 (= V319), D310 (= D338), I311 (= I339), D329 (= D357), V330 (≠ A358), M405 (= M428), G423 (= G446)
- binding magnesium ion: A37 (= A47), T82 (= T101), S83 (= S102), Q122 (= Q141), Y381 (≠ R404), D453 (= D476), M458 (= M481), Q461 (≠ G484), N480 (= N503), H482 (≠ G505), K533 (≠ P551)
P07342 Acetolactate synthase catalytic subunit, mitochondrial; Acetohydroxy-acid synthase catalytic subunit; AHAS; ALS; EC 2.2.1.6 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
44% identity, 92% coverage: 22:595/621 of query aligns to 92:666/687 of P07342
- R241 (= R180) binding
- 355:376 (vs. 293:314, 64% identical) binding
- 407:426 (vs. 338:357, 30% identical) binding
1n0hA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, chlorimuron ethyl (see paper)
44% identity, 92% coverage: 22:595/621 of query aligns to 10:578/599 of 1n0hA
- active site: Y31 (= Y43), G33 (= G45), G34 (= G46), A35 (= A47), I36 (= I48), E57 (= E78), T80 (= T101), F119 (= F140), Q120 (= Q141), E121 (= E142), K169 (= K190), R230 (≠ A256), M266 (= M292), V293 (= V319), V409 (= V423), L434 (≠ M448), G435 (= G449), M437 (= M451), D462 (= D476), N489 (= N503), E491 (≠ G505), Q492 (≠ D506), M494 (= M508), V495 (≠ I509), W498 (= W512), L520 (≠ A536), G525 (= G541), L526 (≠ F542), K559 (≠ Q576)
- binding 4-{[(4'-amino-2'-methylpyrimidin-5'-yl)methyl]amino}pent-3-enyl diphosphate: V409 (= V423), G410 (= G424), Q411 (= Q425), H412 (= H426), G435 (= G449), M437 (= M451), G461 (= G475), D462 (= D476), A463 (≠ G477), S464 (= S478), M467 (= M481), N489 (= N503), E491 (≠ G505), Q492 (≠ D506), G493 (= G507), V495 (≠ I509)
- binding 2-[[[[(4-chloro-6-methoxy-2-pyrimidinyl)amino]carbonyl]amino]sulfonyl]benzoic acid ethyl ester: G34 (= G46), A35 (= A47), V109 (= V130), P110 (= P131), F119 (= F140), K169 (= K190), M266 (= M292), D291 (= D317), R292 (= R318), V495 (≠ I509), W498 (= W512)
- binding flavin-adenine dinucleotide: R159 (= R180), G219 (= G246), A220 (≠ G247), G221 (= G248), N224 (≠ A251), T246 (= T272), L247 (= L273), Q248 (≠ M274), L264 (= L290), G265 (= G291), M266 (= M292), H267 (= H293), G286 (= G312), A287 (= A313), R288 (= R314), D290 (= D316), R292 (= R318), V293 (= V319), E319 (≠ D338), V320 (≠ I339), N324 (≠ E343), G337 (= G356), D338 (= D357), A339 (= A358), M414 (= M428), G432 (= G446), G433 (≠ S447)
- binding magnesium ion: D462 (= D476), N489 (= N503), E491 (≠ G505)
- binding thiamine diphosphate: Y31 (= Y43), E57 (= E78), P83 (= P104)
6u9dB Saccharomyces cerevisiae acetohydroxyacid synthase (see paper)
44% identity, 92% coverage: 22:595/621 of query aligns to 12:586/607 of 6u9dB
- active site: Y33 (= Y43), G35 (= G45), G36 (= G46), A37 (= A47), I38 (= I48), E59 (= E78), T82 (= T101), F121 (= F140), Q122 (= Q141), E123 (= E142), K171 (= K190), M274 (= M292), V301 (= V319), V417 (= V423), G443 (= G449), M445 (= M451), D470 (= D476), N497 (= N503), E499 (≠ G505), Q500 (≠ D506), M502 (= M508), V503 (≠ I509), W506 (= W512)
- binding methyl 2-[(4,6-dimethoxypyrimidin-2-yl)carbamoylsulfamoylmethyl]benzoate: G36 (= G46), V111 (= V130), P112 (= P131), F121 (= F140), K171 (= K190), D299 (= D317), R300 (= R318), M502 (= M508), W506 (= W512)
- binding flavin-adenine dinucleotide: R161 (= R180), A228 (≠ G247), G229 (= G248), N232 (≠ A251), T254 (= T272), L255 (= L273), Q256 (≠ M274), L272 (= L290), M274 (= M292), G294 (= G312), R296 (= R314), D298 (= D316), R300 (= R318), V301 (= V319), E327 (≠ D338), V328 (≠ I339), N332 (≠ E343), D346 (= D357), A347 (= A358), M422 (= M428), G440 (= G446), G441 (≠ S447)
- binding magnesium ion: D470 (= D476), N497 (= N503)
- binding thiamine diphosphate: E59 (= E78), P85 (= P104), V417 (= V423), G418 (= G424), Q419 (= Q425), H420 (= H426), G443 (= G449), M445 (= M451), A471 (≠ G477), S472 (= S478), N497 (= N503), E499 (≠ G505), Q500 (≠ D506), G501 (= G507), M502 (= M508), V503 (≠ I509)
Query Sequence
>H281DRAFT_00356 FitnessBrowser__Burk376:H281DRAFT_00356
MTTNLNVASQVCPVPTLPGEPMSGADIILRVLAEQGVDTLFGYSGGAILPTYDAVFRFNE
SHAARPERQIKFVVPANEQAAGFMAAGYARASGKVGVFMVTSGPGATNAVTPIADCNGDS
IPVVLICGQVPRAAIGSDAFQEAPVFNIMSACAKQVFLVTDPAKLEQTLRTAFEIARTGR
PGPVVVDVPKDIQNWVGQYQGQGTLHFRGYSDRLQLVANGSRLDEQKGAQFFDLLRQSER
PLLYVGGGVIAAGATAELRQFAERYEIPVVTTLMGLGAIPAQHPLSLGMLGMHGAACANY
AVEDCDFLIAVGARFDDRVAGGRPDMFAAGARHVAHIDIDEAEINKVKRAHWSHIGDARQ
ALRALMEHESVALSSALWIGWVTELRQRHGMNYDRSNPLIQPQRVIEKLSEITGGRAIIS
TGVGQHQMWTAQFYQFTEPRSFLTSGSMGTMGFGLPAAIGAQLARPDALVIDIDGDGSIR
MNAGELETASTYGVPVKVLLLNNRGDGMIRQWQRLFYEGRTFVSDKALHRKDFVMAARAD
GFEFACRVETPSELDEKLKAFVAFEGPAFLEVMIDQNADVFPMVGPGQSYSNMITGPFIA
SRSETVAGEEGAVRLQAADMF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory