SitesBLAST
Comparing H281DRAFT_00361 H281DRAFT_00361 short chain enoyl-CoA hydratase /3-hydroxyacyl-CoA dehydrogenase to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6iunB Crystal structure of enoyl-coa hydratase (ech) from ralstonia eutropha h16 in complex with NAD
44% identity, 97% coverage: 13:699/706 of query aligns to 5:690/692 of 6iunB
- active site: A60 (= A68), F65 (= F73), E73 (≠ P79), H77 (≠ P83), G101 (= G107), E104 (= E110), E124 (= E130), G132 (= G138), K248 (≠ R258), S407 (= S416), H428 (= H437), E440 (= E449), N478 (= N487)
- binding nicotinamide-adenine-dinucleotide: G300 (= G309), T301 (= T310), M302 (= M311), E321 (= E330), T322 (≠ R331), Y365 (= Y374), A377 (= A386), V378 (= V387), E380 (= E389), V384 (= V393), V388 (= V397), N405 (= N414), S407 (= S416)
Q08426 Peroxisomal bifunctional enzyme; PBE; PBFE; L-bifunctional protein; LBP; Multifunctional enzyme 1; MFE1; EC 4.2.1.17; EC 5.3.3.8; EC 1.1.1.35 from Homo sapiens (Human) (see 5 papers)
42% identity, 94% coverage: 14:680/706 of query aligns to 7:687/723 of Q08426
- V40 (≠ D47) to G: in dbSNP:rs1062551
- I41 (≠ S48) to R: in dbSNP:rs1062552
- T75 (≠ S81) to I: in dbSNP:rs1062553
- K165 (≠ A171) modified: N6-acetyllysine; alternate; mutation to Q: Greatly reduced acetylation and insensitive to treatment with TSA and NAM; when associated with Q-171; Q-346 and Q-584.
- K171 (≠ R177) modified: N6-acetyllysine; mutation to Q: Greatly reduced acetylation and insensitive to treatment with TSA and NAM; when associated with Q-165; Q-346 and Q-584.
- A274 (= A282) to T: in dbSNP:rs2302819
- A325 (≠ M328) to G: in dbSNP:rs1062555
- K346 (≠ M356) modified: N6-acetyllysine; mutation to Q: Greatly reduced acetylation and insensitive to treatment with TSA and NAM; when associated with Q-165; Q-171 and Q-584.
- K584 (vs. gap) modified: N6-acetyllysine; alternate; mutation to Q: Greatly reduced acetylation and insensitive to treatment with TSA and NAM; when associated with Q-165; Q-171 and Q-346.
- K598 (≠ A591) to T: in dbSNP:rs1042437
- T606 (≠ R599) to P: in dbSNP:rs1042438
Sites not aligning to the query:
- 3 E → K: in FRTS3; the mutant is mistargeted to mitochondria; results in impaired mitochondrial oxidative phosphorylation and defects in the transport of fluids across the epithelium of renal proximal tubular cells; dbSNP:rs398124646
3zw9A Crystal structure of rat peroxisomal multifunctional enzyme type 1 (rpmfe1) complexed with (2s,3s)-3-hydroxy-2- methylbutanoyl-coa (see paper)
39% identity, 94% coverage: 20:680/706 of query aligns to 16:689/723 of 3zw9A
- active site: A64 (= A68), F69 (= F73), G79 (≠ P83), G103 (= G107), E106 (= E110), P125 (= P129), E126 (= E130), P133 (= P137), G134 (= G138), K252 (≠ R258), S413 (= S416), H434 (= H437), E446 (= E449), N484 (= N487)
- binding nicotinamide-adenine-dinucleotide: L305 (≠ V306), G306 (= G307), G308 (= G309), T309 (= T310), M310 (= M311), E329 (= E330), Q334 (≠ S335), A383 (= A386), V384 (= V387), F385 (= F388), E386 (= E389), N411 (= N414), S413 (= S416), H434 (= H437)
- binding (2s,3s)-3-hydroxy-2-methylbutanoyl-coa: V24 (= V28), A62 (= A66), G63 (= G67), A64 (= A68), I66 (= I70), G102 (= G106), G103 (= G107), E106 (= E110), E126 (= E130), P133 (= P137), Y159 (≠ H163)
5omoA Crystal structure of rat peroxisomal multifunctional enzyme type-1 (rpmfe1) complexed with with 3s-hydroxy-decanoyl-coa and 3-keto- decanoyl-coa
39% identity, 94% coverage: 20:680/706 of query aligns to 18:691/725 of 5omoA
- active site: A66 (= A68), F71 (= F73), G81 (≠ P83), G105 (= G107), E108 (= E110), P127 (= P129), E128 (= E130), P135 (= P137), G136 (= G138), K254 (≠ R258), S415 (= S416), H436 (= H437), E448 (= E449), N486 (= N487)
- binding (s)-3-hydroxydecanoyl-coa: P25 (= P27), V26 (= V28), A28 (= A30), P31 (≠ A33), A64 (= A66), A66 (= A68), D67 (= D69), I68 (= I70), L103 (= L105), G105 (= G107), E108 (= E110), P127 (= P129), E128 (= E130), Y161 (≠ H163), F260 (= F264), K280 (≠ R284)
- binding 3-keto-decanoyl-coa: S415 (= S416), N486 (= N487), K519 (≠ P520), M520 (= M521), V525 (= V526), Y658 (= Y647)
5mgbA Crystal structure of rat peroxisomal multifunctional enzyme type-1 (rpmfe1) complexed with acetoacetyl-coa and NAD (see paper)
39% identity, 94% coverage: 20:680/706 of query aligns to 18:691/725 of 5mgbA
- active site: A66 (= A68), F71 (= F73), G81 (≠ P83), G105 (= G107), E108 (= E110), P127 (= P129), E128 (= E130), P135 (= P137), G136 (= G138), K254 (≠ R258), S415 (= S416), H436 (= H437), E448 (= E449), N486 (= N487)
- binding acetoacetyl-coenzyme a: P25 (= P27), V26 (= V28), A64 (= A66), G65 (= G67), A66 (= A68), D67 (= D69), I68 (= I70), G105 (= G107), E128 (= E130), Y161 (≠ H163)
- binding nicotinamide-adenine-dinucleotide: L307 (≠ V306), G308 (= G307), G310 (= G309), T311 (= T310), M312 (= M311), E331 (= E330), S332 (≠ R331), Q336 (≠ S335), V386 (= V387), F387 (= F388), E388 (= E389), N413 (= N414), S415 (= S416), H436 (= H437)
3zwcA Crystal structure of rat peroxisomal multifunctional enzyme type 1 (rpmfe1) complexed with 3s-hydroxy-decanoyl-coa (see paper)
39% identity, 94% coverage: 20:680/706 of query aligns to 18:691/725 of 3zwcA
- active site: A66 (= A68), F71 (= F73), G81 (≠ P83), G105 (= G107), E108 (= E110), P127 (= P129), E128 (= E130), P135 (= P137), G136 (= G138), K254 (≠ R258), S415 (= S416), H436 (= H437), E448 (= E449), N486 (= N487)
- binding (s)-3-hydroxydecanoyl-coa: V26 (= V28), A64 (= A66), G65 (= G67), A66 (= A68), D67 (= D69), I68 (= I70), G77 (≠ P79), L78 (≠ P80), L80 (= L82), V101 (≠ A103), G104 (= G106), G105 (= G107), E108 (= E110), E128 (= E130), F260 (= F264)
- binding nicotinamide-adenine-dinucleotide: G308 (= G307), G310 (= G309), T311 (= T310), M312 (= M311), E331 (= E330), Q336 (≠ S335), A385 (= A386), V386 (= V387), F387 (= F388), E388 (= E389), K393 (= K394), N413 (= N414), S415 (= S416), H436 (= H437)
2x58A The crystal structure of mfe1 liganded with coa (see paper)
39% identity, 94% coverage: 20:680/706 of query aligns to 18:691/725 of 2x58A
- active site: A66 (= A68), F71 (= F73), G81 (≠ P83), G105 (= G107), E108 (= E110), P127 (= P129), E128 (= E130), P135 (= P137), G136 (= G138), K254 (≠ R258), S415 (= S416), H436 (= H437), E448 (= E449), N486 (= N487)
- binding adenosine-5'-diphosphate: G310 (= G309), T311 (= T310), M312 (= M311), E331 (= E330), S332 (≠ R331), Q336 (≠ S335), V386 (= V387), L392 (≠ V393)
- binding coenzyme a: V26 (= V28), A28 (= A30), A64 (= A66), A66 (= A68), D67 (= D69), I68 (= I70), E128 (= E130)
3zwaA Crystal structure of rat peroxisomal multifunctional enzyme type 1 (rpmfe1) complexed with 3s-hydroxy-hexanoyl-coa (see paper)
39% identity, 94% coverage: 20:680/706 of query aligns to 19:692/727 of 3zwaA
- active site: A67 (= A68), F72 (= F73), G82 (≠ P83), G106 (= G107), E109 (= E110), P128 (= P129), E129 (= E130), P136 (= P137), G137 (= G138), K255 (≠ R258), S416 (= S416), H437 (= H437), E449 (= E449), N487 (= N487)
- binding (S)-3-Hydroxyhexanoyl-CoA: V27 (= V28), A65 (= A66), G66 (= G67), A67 (= A68), D68 (= D69), I69 (= I70), L104 (= L105), E109 (= E110), R124 (≠ K125), E129 (= E130), L132 (= L133), G137 (= G138), Y162 (≠ H163)
6zibAAA structure of rat peroxisomal multifunctional enzyme type-1 (rpmfe1) complexed with acetoacetyl-coa and nadh'
40% identity, 94% coverage: 20:680/706 of query aligns to 18:689/723 of 6zibAAA
- active site: A66 (= A68), F71 (= F73), G81 (≠ P83), G105 (= G107), E108 (= E110), P127 (= P129), E128 (= E130), G136 (= G138), K254 (≠ R258), S413 (= S416), H434 (= H437), E446 (= E449), N484 (= N487)
- binding acetoacetyl-coenzyme a: P25 (= P27), V26 (= V28), A64 (= A66), G65 (= G67), A66 (= A68), D67 (= D69), I68 (= I70), G104 (= G106), G105 (= G107), E128 (= E130), Y161 (≠ H163)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G310 (= G309), T311 (= T310), M312 (= M311), E331 (= E330), S332 (≠ R331), Q336 (≠ S335), A383 (= A386), V384 (= V387), F385 (= F388), E386 (= E389), N411 (= N414), H434 (= H437)
6zicAAA structure of rat peroxisomal multifunctional enzyme type-1 (rpmfe1) complexed with 3s-hydroxybutanoyl-coa and nadh'
40% identity, 94% coverage: 20:680/706 of query aligns to 18:689/723 of 6zicAAA
- active site: A66 (= A68), F71 (= F73), G81 (≠ P83), G105 (= G107), E108 (= E110), P127 (= P129), E128 (= E130), G136 (= G138), K254 (≠ R258), S413 (= S416), H434 (= H437), E446 (= E449), N484 (= N487)
- binding 3-hydroxybutanoyl-coenzyme a: P25 (= P27), V26 (= V28), A28 (= A30), A66 (= A68), D67 (= D69), I68 (= I70), G104 (= G106), G105 (= G107), E108 (= E110), E128 (= E130), Y161 (≠ H163)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G308 (= G307), G310 (= G309), T311 (= T310), M312 (= M311), E331 (= E330), S332 (≠ R331), Q336 (≠ S335), A383 (= A386), V384 (= V387), F385 (= F388), E386 (= E389), L390 (≠ V393), K391 (= K394), N411 (= N414), S413 (= S416), H434 (= H437)
3zwbA Crystal structure of rat peroxisomal multifunctional enzyme type 1 (rpmfe1) complexed with 2trans-hexenoyl-coa (see paper)
39% identity, 94% coverage: 20:680/706 of query aligns to 18:691/725 of 3zwbA
- active site: A66 (= A68), G81 (≠ P83), G105 (= G107), E108 (= E110), P127 (= P129), A128 (≠ E130), P135 (= P137), G136 (= G138), S415 (= S416), H436 (= H437), E448 (= E449), N486 (= N487)
- binding (2E)-Hexenoyl-CoA: P25 (= P27), V26 (= V28), A28 (= A30), A64 (= A66), G65 (= G67), A66 (= A68), D67 (= D69), I68 (= I70), V101 (≠ A103), L103 (= L105), G105 (= G107), E108 (= E110), G136 (= G138), Y161 (≠ H163), K280 (≠ R284)
6z5oAAA Peroxisomal bifunctional enzyme (see paper)
40% identity, 94% coverage: 20:680/706 of query aligns to 19:685/716 of 6z5oAAA
- active site: A67 (= A68), F72 (= F73), G82 (≠ P83), G106 (= G107), E109 (= E110), P128 (= P129), E129 (= E130), G137 (= G138), K255 (≠ R258), S409 (= S416), H430 (= H437), E442 (= E449), N480 (= N487)
- binding coenzyme a: P26 (= P27), V27 (= V28), A65 (= A66), D68 (= D69), I69 (= I70), P128 (= P129), Y162 (≠ H163), F277 (= F280), K281 (≠ R284)
- binding nicotinamide-adenine-dinucleotide: G309 (= G307), G311 (= G309), T312 (= T310), M313 (= M311), E332 (= E330), S333 (≠ R331), Q337 (≠ S335), A379 (= A386), V380 (= V387), F381 (= F388), E382 (= E389), K387 (= K394), N407 (= N414), S409 (= S416), H430 (= H437)
- binding nicotinamide: A67 (= A68), E109 (= E110), E129 (= E130), P136 (= P137), F261 (= F264)
6yswA E. Coli anaerobic trifunctional enzyme subunit-alpha in complex with coenzyme a
36% identity, 97% coverage: 17:699/706 of query aligns to 12:702/707 of 6yswA
- active site: A66 (= A68), I71 (≠ F73), A84 (≠ C86), Q88 (vs. gap), G112 (= G107), E115 (= E110), P136 (= P129), E137 (= E130), G145 (= G138), D264 (≠ R258), S422 (= S416), H443 (= H437), E455 (= E449), N493 (= N487)
- binding coenzyme a: E23 (≠ A26), M25 (≠ V28), A66 (= A68), D67 (= D69), I68 (= I70), P136 (= P129), E137 (= E130), L140 (= L133), T290 (≠ R284), K293 (≠ L287)
P40939 Trifunctional enzyme subunit alpha, mitochondrial; 78 kDa gastrin-binding protein; Monolysocardiolipin acyltransferase; TP-alpha; EC 2.3.1.-; EC 4.2.1.17; EC 1.1.1.211 from Homo sapiens (Human) (see 5 papers)
32% identity, 95% coverage: 2:675/706 of query aligns to 28:736/763 of P40939
- V282 (≠ T228) to D: in MTPD1; mild phenotype with slowly progressive myopathy and sensorimotor polyneuropathy; dbSNP:rs137852773
- I305 (≠ V242) to N: in MTPD1; mild phenotype with slowly progressive myopathy and sensorimotor polyneuropathy; dbSNP:rs137852774
- L342 (= L276) to P: in LCHAD deficiency; dbSNP:rs137852772
- E510 (= E449) active site, For hydroxyacyl-coenzyme A dehydrogenase activity; to Q: in AFLP and LCHAD deficiency; loss of long-chain-3-hydroxyacyl-CoA dehydrogenase activity; dbSNP:rs137852769
1wdlA Fatty acid beta-oxidation multienzyme complex from pseudomonas fragi, form ii (native4) (see paper)
32% identity, 95% coverage: 28:699/706 of query aligns to 29:713/715 of 1wdlA
- active site: A69 (= A68), N89 (≠ R88), N93 (vs. gap), G117 (= G107), E120 (= E110), P139 (= P129), E140 (= E130), P147 (= P137), G148 (= G138), S430 (= S416), H451 (= H437), E463 (= E449), N501 (= N487)
- binding nicotinamide-adenine-dinucleotide: A322 (≠ G308), I324 (≠ T310), M325 (= M311), D344 (≠ E330), I345 (≠ R331), A400 (= A386), V401 (= V387), E403 (= E389), N428 (= N414), T429 (= T415), S430 (= S416)
P28793 Fatty acid oxidation complex subunit alpha; EC 4.2.1.17; EC 5.1.2.3; EC 5.3.3.8; EC 1.1.1.35 from Pseudomonas fragi (see paper)
32% identity, 95% coverage: 28:699/706 of query aligns to 29:713/715 of P28793
1wdmA Fatty acid beta-oxidation multienzyme complex from pseudomonas fragi, form i (native3) (see paper)
32% identity, 95% coverage: 28:699/706 of query aligns to 29:705/707 of 1wdmA
- active site: A69 (= A68), N89 (≠ R88), N93 (vs. gap), G117 (= G107), E120 (= E110), P139 (= P129), E140 (= E130), P147 (= P137), G148 (= G138), S430 (= S416), H451 (= H437), E463 (= E449), N501 (= N487)
- binding acetyl coenzyme *a: K142 (≠ Q132), D297 (≠ E283), M459 (= M445), N501 (= N487), P534 (= P520), Y652 (= Y645), L658 (≠ R651)
- binding nicotinamide-adenine-dinucleotide: G321 (= G307), A322 (≠ G308), I324 (≠ T310), M325 (= M311), D344 (≠ E330), V401 (= V387), E403 (= E389), N428 (= N414), S430 (= S416), N454 (≠ S440)
6tnmA E. Coli aerobic trifunctional enzyme subunit-alpha (see paper)
31% identity, 93% coverage: 28:682/706 of query aligns to 28:697/719 of 6tnmA
- active site: A68 (= A68), F73 (= F73), G116 (= G107), E119 (= E110), P138 (= P129), E139 (= E130), G147 (= G138), N271 (≠ R258), S429 (= S416), H450 (= H437), E462 (= E449), N500 (= N487)
- binding adenosine-5'-triphosphate: D343 (≠ E330), I344 (≠ R331), V400 (= V387), V401 (≠ F388), V406 (= V393), K584 (= K568)
P21177 Fatty acid oxidation complex subunit alpha; EC 4.2.1.17; EC 5.1.2.3; EC 5.3.3.8; EC 1.1.1.35 from Escherichia coli (strain K12) (see 2 papers)
31% identity, 93% coverage: 28:682/706 of query aligns to 28:697/729 of P21177
- G116 (= G107) mutation to F: Absence of both enoyl-CoA hydratase and 3-hydroxyacyl-CoA epimerase activities. Delta(3)-cis-Delta(2)-trans-enoyl-CoA isomerase is only slightly affected.
- G322 (= G309) mutation to A: 10-fold increase in KM for NADH.
- H450 (= H437) active site, For 3-hydroxyacyl-CoA dehydrogenase activity; mutation H->A,Q: Almost complete loss of 3-hydroxyacyl-CoA dehydrogenase activity.
4b3iA Crystal structure of mycobacterium tuberculosis fatty acid beta-oxidation complex with coenzymea bound at the hydratase active sites (see paper)
31% identity, 86% coverage: 51:659/706 of query aligns to 62:693/731 of 4b3iA
- active site: G79 (≠ A68), E100 (= E90), R104 (vs. gap), G127 (= G107), E130 (= E110), P151 (= P129), E152 (= E130), G160 (= G138), S452 (= S416), H473 (= H437), E485 (= E449), S523 (≠ N487)
- binding adenosine-5'-diphosphate: Q640 (≠ P604), P641 (≠ R605), P642 (≠ E606), L643 (≠ F607), Q644 (≠ S608)
- binding coenzyme a: A77 (= A66), G79 (≠ A68), D80 (= D69), V81 (≠ I70), E152 (= E130), F315 (= F281), Q319 (≠ E285)
Sites not aligning to the query:
Query Sequence
>H281DRAFT_00361 H281DRAFT_00361 short chain enoyl-CoA hydratase /3-hydroxyacyl-CoA dehydrogenase
MSLTTSTDVVTRELRGKVLLVTIDHAPVNALSADVRRGLLAAIEAADSDPSVQAVLIVGA
GRNFIAGADIREFGKPPVPPSLPDVCNRIEACTKPVVAAIHGAALGGGLEVALAAHYRLA
VDGAKLGLPEVQLGLLPGAGGTQRTPRLIGAQAALDLMLSGRHANAQEALALGLVDRLGS
SDDILAEGLAYVHELLAGHAPVRRTRDATALNDRASSLAAVATARAETAKKSRGLFSPLK
IVDAVEAAIAQPFEDGLRRERQLFLECLDSPQRAGLVHAFFAEREVLKAPETRDTKPRAL
NAIGVVGGGTMGAGIAVAVLDAGLPVTMIERDEASLARGRAHIEKVYDGLIAKGRMSAEK
KAQLMARWTGSTSYDALADADLVIEAVFEDLSVKQAVFAELDRVCKPGAVLATNTSYLDI
DAIAASISRPADVIGLHFFSPANIMKLLEVVVPKAVSADVVATAFELAKKLRKTPVRAGV
CDGFIGNRILAVYRSAADAMMEDGASPYQIDAAVRAFGFPMGPFQVVDLAGGDIGWAARK
RRAATRNPAARYVQIADRLCERGWFGQKTGRGFYLYPEGSRSGQPDPEVEAIIDAERVRA
GITPREFSDDEIIRRYMAAMINEGANVVHERIALRPLDVDVTFLYGYGFPRYRGGPMKYA
DMIGLPRILADIREFAKEDPLFWRASPLLIDLVERGADFASLNHAA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory