Comparing H281DRAFT_00373 FitnessBrowser__Burk376:H281DRAFT_00373 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5zaiC Crystal structure of 3-hydroxypropionyl-coa dehydratase from metallosphaera sedula (see paper)
32% identity, 34% coverage: 51:240/556 of query aligns to 24:202/259 of 5zaiC
Sites not aligning to the query:
6yswA E. Coli anaerobic trifunctional enzyme subunit-alpha in complex with coenzyme a
33% identity, 35% coverage: 51:245/556 of query aligns to 24:206/707 of 6yswA
Sites not aligning to the query:
P40939 Trifunctional enzyme subunit alpha, mitochondrial; 78 kDa gastrin-binding protein; Monolysocardiolipin acyltransferase; TP-alpha; EC 2.3.1.-; EC 4.2.1.17; EC 1.1.1.211 from Homo sapiens (Human) (see 5 papers)
34% identity, 29% coverage: 62:222/556 of query aligns to 67:224/763 of P40939
Sites not aligning to the query:
5jbxB Crystal structure of liuc in complex with coenzyme a and malonic acid (see paper)
35% identity, 22% coverage: 62:184/556 of query aligns to 36:150/261 of 5jbxB
Sites not aligning to the query:
2hw5C The crystal structure of human enoyl-coenzyme a (coa) hydratase short chain 1, echs1
30% identity, 42% coverage: 52:284/556 of query aligns to 28:252/260 of 2hw5C
Sites not aligning to the query:
1mj3A Crystal structure analysis of rat enoyl-coa hydratase in complex with hexadienoyl-coa (see paper)
34% identity, 24% coverage: 52:185/556 of query aligns to 28:148/258 of 1mj3A
Sites not aligning to the query:
2dubA Enoyl-coa hydratase complexed with octanoyl-coa (see paper)
33% identity, 24% coverage: 52:185/556 of query aligns to 27:144/254 of 2dubA
Sites not aligning to the query:
Q4WF54 Mevalonyl-coenzyme A hydratase sidH; Siderophore biosynthesis protein H; EC 4.2.1.- from Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) (Neosartorya fumigata) (see paper)
30% identity, 31% coverage: 74:244/556 of query aligns to 53:209/270 of Q4WF54
Sites not aligning to the query:
6iunB Crystal structure of enoyl-coa hydratase (ech) from ralstonia eutropha h16 in complex with NAD
28% identity, 28% coverage: 77:230/556 of query aligns to 44:183/692 of 6iunB
Sites not aligning to the query:
P21177 Fatty acid oxidation complex subunit alpha; EC 4.2.1.17; EC 5.1.2.3; EC 5.3.3.8; EC 1.1.1.35 from Escherichia coli (strain K12) (see 2 papers)
30% identity, 32% coverage: 52:231/556 of query aligns to 28:199/729 of P21177
Sites not aligning to the query:
6tnmA E. Coli aerobic trifunctional enzyme subunit-alpha (see paper)
30% identity, 32% coverage: 52:231/556 of query aligns to 28:199/719 of 6tnmA
Sites not aligning to the query:
3q0gD Crystal structure of the mycobacterium tuberculosis crotonase bound to a reaction intermediate derived from crotonyl coa
30% identity, 28% coverage: 133:287/556 of query aligns to 93:248/250 of 3q0gD
Sites not aligning to the query:
3q0jC Crystal structure of the mycobacterium tuberculosis crotonase in complex with the inhibitor acetoacetylcoa
30% identity, 28% coverage: 133:287/556 of query aligns to 98:253/255 of 3q0jC
Sites not aligning to the query:
3q0gC Crystal structure of the mycobacterium tuberculosis crotonase bound to a reaction intermediate derived from crotonyl coa
30% identity, 28% coverage: 133:287/556 of query aligns to 98:253/255 of 3q0gC
Sites not aligning to the query:
7o4uA Structure of the alpha subunit of mycobacterium tuberculosis beta- oxidation trifunctional enzyme in complex with oxidized nicotinamide adenine dinucleotide (see paper)
32% identity, 19% coverage: 63:169/556 of query aligns to 36:140/711 of 7o4uA
Sites not aligning to the query:
8pf8A Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-72
32% identity, 19% coverage: 63:169/556 of query aligns to 47:151/729 of 8pf8A
Sites not aligning to the query:
8oquA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-92
32% identity, 19% coverage: 63:169/556 of query aligns to 48:152/730 of 8oquA
Sites not aligning to the query:
8oqtA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-91
32% identity, 19% coverage: 63:169/556 of query aligns to 47:151/729 of 8oqtA
Sites not aligning to the query:
8oqnA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-53
32% identity, 19% coverage: 63:169/556 of query aligns to 47:151/729 of 8oqnA
Sites not aligning to the query:
8opvA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with resveratrol (fragment-b-h11)
32% identity, 19% coverage: 63:169/556 of query aligns to 47:151/729 of 8opvA
Sites not aligning to the query:
>H281DRAFT_00373 FitnessBrowser__Burk376:H281DRAFT_00373
MSTAEAAIAPVDYRTDPSQYKHWKLSFNGPVATLGIDIAEDGGIRDGYKLKLNSYDLGVD
IELHDAIQRIRFEHPEVKTVVLTSLKDRVFCSGANIFMLGLSSHAWKVNFCKFTNETRNG
LEDSSRHSGLKFLAAVNGACAGGGYELALACDEIYLVDDRSSSVSLPEVPLLGVLPGTGG
LTRVTDKRKVRHDRADIFCTVVEGIRGERAKAWRLVDEVVKPNQFDQAIQARALELAAQS
DRPSDAQGVMLTRIQRTDRDDGLTYRTLDVTIDRAKRIATFTAKAPQTEQPTNIDVIVAA
GANWWPLQFARELDDAILSMRTNELEVGTWIFRTEGDARNVLAADAVLMQHKDHWFVRET
IGMLRRTLARIDVSSRSLFALIEPGSCFAGTFAELAFAADRSYMAALPGNEEEEPAITLS
EANFGLYPMVTHQSRLARRFYEEAAPLDAVRSLIGQAVKPVEAERLGLVTAAPDDIDWAD
EIRIALEERAAMSPDALTGLEANLRFNGPETMETRIFGRLTAWQNWIFNRPNAVGEKGAL
KVYGKGSKAQFDVSRV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory