SitesBLAST
Comparing H281DRAFT_00375 FitnessBrowser__Burk376:H281DRAFT_00375 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2b5oA Ferredoxin-NADP reductase
36% identity, 67% coverage: 137:413/413 of query aligns to 4:292/292 of 2b5oA
- active site: Y71 (= Y204), S72 (= S205), C250 (= C371), E290 (= E411), Y292 (= Y413)
- binding flavin-adenine dinucleotide: R69 (= R202), L70 (≠ Q203), Y71 (= Y204), S72 (= S205), C90 (≠ T223), Y96 (≠ Q229), G107 (= G237), V108 (= V238), C109 (= C239), S110 (= S240), T150 (= T279), E290 (= E411), Y292 (= Y413)
1ewyA Anabaena pcc7119 ferredoxin:ferredoxin-NADP+-reductase complex (see paper)
34% identity, 67% coverage: 137:413/413 of query aligns to 12:303/303 of 1ewyA
- active site: Y79 (= Y204), S80 (= S205), C261 (= C371), E301 (= E411), Y303 (= Y413)
- binding flavin-adenine dinucleotide: R77 (= R202), L78 (≠ Q203), Y79 (= Y204), S80 (= S205), C98 (≠ T223), L102 (≠ V227), Y104 (≠ Q229), G115 (= G237), V116 (= V238), C117 (= C239), S118 (= S240), E301 (= E411), Y303 (= Y413)
1queA X-ray structure of the ferredoxin:nadp+ reductase from the cyanobacterium anabaena pcc 7119 at 1.8 angstroms (see paper)
34% identity, 67% coverage: 137:413/413 of query aligns to 12:303/303 of 1queA
- active site: Y79 (= Y204), S80 (= S205), C261 (= C371), E301 (= E411), Y303 (= Y413)
- binding flavin-adenine dinucleotide: R77 (= R202), L78 (≠ Q203), Y79 (= Y204), S80 (= S205), C98 (≠ T223), L102 (≠ V227), Y104 (≠ Q229), K105 (≠ R230), G115 (= G237), V116 (= V238), C117 (= C239), S118 (= S240), T157 (= T279), E301 (= E411), Y303 (= Y413)
- binding sulfate ion: S223 (= S336), R224 (= R337), R233 (≠ K343), Y235 (= Y345)
1gjrA Ferredoxin-NADP+ reductase complexed with NADP+ by cocrystallization (see paper)
34% identity, 67% coverage: 137:413/413 of query aligns to 4:295/295 of 1gjrA
- active site: Y71 (= Y204), S72 (= S205), C253 (= C371), E293 (= E411), Y295 (= Y413)
- binding flavin-adenine dinucleotide: R69 (= R202), L70 (≠ Q203), Y71 (= Y204), S72 (= S205), C90 (≠ T223), L94 (≠ V227), Y96 (≠ Q229), G107 (= G237), V108 (= V238), C109 (= C239), S110 (= S240), T149 (= T279), E293 (= E411), Y295 (= Y413)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R92 (≠ K225), L94 (≠ V227), T147 (= T277), G148 (= G278), T149 (= T279), P186 (≠ R310), S215 (= S336), R216 (= R337), R225 (≠ K343), Y227 (= Y345), Q229 (= Q347), G254 (= G372), L255 (= L373), Y295 (= Y413)
1gawB Crystal structure analysis of the ferredoxin-NADP+ reductase from maize leaf (see paper)
35% identity, 67% coverage: 138:413/413 of query aligns to 21:305/305 of 1gawB
- active site: Y86 (= Y204), S87 (= S205), C263 (= C371), E303 (= E411), Y305 (= Y413)
- binding flavin-adenine dinucleotide: R84 (= R202), L85 (≠ Q203), Y86 (= Y204), S87 (= S205), C105 (≠ T223), Y111 (≠ Q229), G121 (= G237), V122 (= V238), C123 (= C239), S124 (= S240), T163 (= T279), Y305 (= Y413)
P00455 Ferredoxin--NADP reductase, chloroplastic; FNR; EC 1.18.1.2 from Spinacia oleracea (Spinach) (see 3 papers)
36% identity, 67% coverage: 137:413/413 of query aligns to 84:369/369 of P00455
- RLYS 148:151 (≠ RQYS 202:205) binding
- CVK 169:171 (≠ TVK 223:225) binding
- Y175 (≠ Q229) binding
- VCS 186:188 (= VCS 238:240) binding
- T227 (= T279) binding
- E367 (= E411) mutation to A: Slightly reduced activity.; mutation E->D,Q: Reduced activity.; mutation to L: Reduces activity by 99%.
Sites not aligning to the query:
- 1:55 modified: transit peptide, Chloroplast
1fncA Refined crystal structure of spinach ferredoxin reductase at 1.7 angstroms resolution: oxidized, reduced, and 2'-phospho-5'-amp bound states (see paper)
35% identity, 67% coverage: 137:413/413 of query aligns to 11:296/296 of 1fncA
- active site: Y77 (= Y204), S78 (= S205), C254 (= C371), E294 (= E411), Y296 (= Y413)
- binding adenosine-2'-5'-diphosphate: K98 (= K225), V186 (≠ A309), P187 (≠ R310), S216 (= S336), R217 (= R337), K226 (= K343), Y228 (= Y345), L256 (= L373), G258 (= G375)
- binding dihydroflavine-adenine dinucleotide: R75 (= R202), L76 (≠ Q203), Y77 (= Y204), S78 (= S205), C96 (≠ T223), L100 (≠ V227), Y102 (≠ Q229), G112 (= G237), V113 (= V238), C114 (= C239), S115 (= S240), T154 (= T279), E294 (= E411), Y296 (= Y413)
3vo2A Crystal structure of zea mays leaf ferredoxin-NADP+ reductase iii (see paper)
35% identity, 67% coverage: 138:413/413 of query aligns to 12:296/296 of 3vo2A
- active site: Y77 (= Y204), S78 (= S205), C254 (= C371), E294 (= E411), Y296 (= Y413)
- binding flavin-adenine dinucleotide: R75 (= R202), L76 (≠ Q203), Y77 (= Y204), S78 (= S205), C96 (≠ T223), V97 (= V224), L100 (≠ V227), Y102 (vs. gap), G112 (= G237), V113 (= V238), C114 (= C239), S115 (= S240), T154 (= T279), E294 (= E411), Y296 (= Y413)
1bx0A Ferredoxin:nadp+ oxidoreductase (ferredoxin reductase) mutant e312l (see paper)
35% identity, 67% coverage: 137:413/413 of query aligns to 11:296/296 of 1bx0A
- active site: Y77 (= Y204), S78 (= S205), C254 (= C371), L294 (≠ E411), Y296 (= Y413)
- binding flavin-adenine dinucleotide: R75 (= R202), L76 (≠ Q203), Y77 (= Y204), S78 (= S205), C96 (≠ T223), Y102 (≠ Q229), G112 (= G237), V113 (= V238), C114 (= C239), S115 (= S240), T154 (= T279), Y296 (= Y413)
P10933 Ferredoxin--NADP reductase, leaf isozyme, chloroplastic; FNR; EC 1.18.1.2 from Pisum sativum (Garden pea) (Lathyrus oleraceus) (see 2 papers)
35% identity, 67% coverage: 137:413/413 of query aligns to 75:360/360 of P10933
- RLYS 139:142 (≠ RQYS 202:205) binding
- S142 (= S205) binding
- CVK 160:162 (≠ TVK 223:225) binding
- K162 (= K225) binding
- Y166 (≠ Q229) binding
- VCS 177:179 (= VCS 238:240) binding
- T218 (= T279) binding
- VP 250:251 (≠ AR 309:310) binding
- SR 280:281 (= SR 336:337) binding
- K290 (= K343) binding
- GL 319:320 (= GL 372:373) binding
- E358 (= E411) binding
- Y360 (= Y413) mutation to F: Results in a 2.0-fold reduction in kcat for the diaphorase reaction.; mutation to G: Results in a 302-fold reduction in kcat for the diaphorase reaction.; mutation to S: Results in a 22-fold reduction in kcat for the diaphorase reaction.; mutation to W: Results in a 2.2-fold reduction in kcat for the diaphorase reaction.
3mhpA Fnr-recruitment to the thylakoid (see paper)
35% identity, 67% coverage: 137:413/413 of query aligns to 10:295/296 of 3mhpA
- active site: Y76 (= Y204), S77 (= S205), C253 (= C371), E293 (= E411), Y295 (= Y413)
- binding flavin-adenine dinucleotide: R74 (= R202), L75 (≠ Q203), Y76 (= Y204), S77 (= S205), C95 (≠ T223), L99 (≠ V227), G111 (= G237), V112 (= V238), C113 (= C239), S114 (= S240), T153 (= T279), E293 (= E411), Y295 (= Y413)
- binding : L25 (≠ G152), T27 (≠ Y154), K28 (≠ R155), I29 (≠ L156), H40 (= H167), F86 (≠ R214), G87 (≠ P215), W163 (vs. gap), F167 (≠ R291), E168 (≠ R292), K169 (≠ R293), E171 (≠ R295), S188 (≠ K312), S189 (≠ E313), E195 (≠ G319), E196 (≠ P320), K199 (≠ N323), K203 (vs. gap)
2vzlA Ferredoxin-NADP reductase (mutations: t155g, a160t, l263p and y303s) complexed with NAD by cocrystallization (see paper)
33% identity, 67% coverage: 137:412/413 of query aligns to 4:294/295 of 2vzlA
- active site: Y71 (= Y204), S72 (= S205), C253 (= C371), E293 (= E411)
- binding flavin-adenine dinucleotide: R69 (= R202), L70 (≠ Q203), Y71 (= Y204), S72 (= S205), C90 (≠ T223), L94 (≠ V227), Y96 (≠ Q229), G107 (= G237), V108 (= V238), C109 (= C239), S110 (= S240), T149 (= T279), E293 (= E411)
- binding nicotinamide-adenine-dinucleotide: S72 (= S205), R92 (≠ K225), T149 (= T279), C253 (= C371), G254 (= G372), P255 (≠ L373), E293 (= E411)
Sites not aligning to the query:
5h59A Ferredoxin-NADP+ reductase from maize root (see paper)
35% identity, 69% coverage: 131:413/413 of query aligns to 14:311/311 of 5h59A
- active site: Y88 (= Y204), S89 (= S205), F268 (≠ V370), C269 (= C371), E309 (= E411), Y311 (= Y413)
- binding flavin-adenine dinucleotide: R86 (= R202), L87 (≠ Q203), Y88 (= Y204), S89 (= S205), C107 (≠ T223), Y113 (≠ Q229), K125 (≠ I235), G127 (= G237), V128 (= V238), C129 (= C239), S130 (= S240), T170 (= T279), Y311 (= Y413)
1qgaA Pea fnr y308w mutant in complex with NADP+ (see paper)
35% identity, 67% coverage: 137:413/413 of query aligns to 23:308/308 of 1qgaA
- active site: Y89 (= Y204), S90 (= S205), C266 (= C371), E306 (= E411), W308 (≠ Y413)
- binding flavin-adenine dinucleotide: R87 (= R202), L88 (≠ Q203), Y89 (= Y204), S90 (= S205), C108 (≠ T223), L112 (≠ V227), Y114 (≠ Q229), G124 (= G237), V125 (= V238), C126 (= C239), S127 (= S240), T166 (= T279), W308 (≠ Y413)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S90 (= S205), K110 (= K225), G165 (= G278), T166 (= T279), G167 (= G280), V198 (≠ A309), P199 (≠ R310), S228 (= S336), R229 (= R337), K238 (= K343), Y240 (= Y345), Q242 (= Q347), C266 (= C371), G267 (= G372), L268 (= L373), E306 (= E411), W308 (≠ Y413)
1qfzA Pea fnr y308s mutant in complex with NADPH (see paper)
35% identity, 67% coverage: 137:412/413 of query aligns to 23:307/308 of 1qfzA
- active site: Y89 (= Y204), S90 (= S205), C266 (= C371), E306 (= E411)
- binding flavin-adenine dinucleotide: R87 (= R202), L88 (≠ Q203), Y89 (= Y204), S90 (= S205), C108 (≠ T223), K110 (= K225), L112 (≠ V227), Y114 (≠ Q229), G124 (= G237), V125 (= V238), C126 (= C239), S127 (= S240), T166 (= T279)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: S90 (= S205), K110 (= K225), G165 (= G278), T166 (= T279), G167 (= G280), V198 (≠ A309), P199 (≠ R310), S228 (= S336), R229 (= R337), Y240 (= Y345), C266 (= C371), G267 (= G372), L268 (= L373), G270 (= G375), E306 (= E411)
Sites not aligning to the query:
1qfyA Pea fnr y308s mutant in complex with NADP+ (see paper)
35% identity, 67% coverage: 137:412/413 of query aligns to 23:307/308 of 1qfyA
- active site: Y89 (= Y204), S90 (= S205), C266 (= C371), E306 (= E411)
- binding flavin-adenine dinucleotide: R87 (= R202), L88 (≠ Q203), Y89 (= Y204), S90 (= S205), C108 (≠ T223), L112 (≠ V227), Y114 (≠ Q229), G124 (= G237), V125 (= V238), C126 (= C239), S127 (= S240), T166 (= T279)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S90 (= S205), K110 (= K225), G165 (= G278), T166 (= T279), G167 (= G280), V198 (≠ A309), P199 (≠ R310), S228 (= S336), R229 (= R337), K238 (= K343), Y240 (= Y345), Q242 (= Q347), C266 (= C371), G267 (= G372), L268 (= L373), G270 (= G375), M271 (= M376), E306 (= E411)
Sites not aligning to the query:
5vw4A Nicotinamide soak of y316s mutant of corn root ferredoxin:nadp+ reductase (see paper)
36% identity, 68% coverage: 131:412/413 of query aligns to 12:308/309 of 5vw4A
- active site: Y86 (= Y204), S87 (= S205), F266 (≠ V370), C267 (= C371), E307 (= E411)
- binding flavin-adenine dinucleotide: R84 (= R202), L85 (≠ Q203), Y86 (= Y204), S87 (= S205), C105 (≠ T223), A109 (≠ V227), Y111 (≠ Q229), K123 (≠ I235), G125 (= G237), V126 (= V238), C127 (= C239), S128 (= S240), T168 (= T279)
- binding nicotinamide: S87 (= S205), T168 (= T279), G169 (= G280), C267 (= C371), G268 (= G372), E307 (= E411), V308 (≠ T412)
Sites not aligning to the query:
5vw2A NADPH soak of y316s mutant of corn root ferredoxin:nadp+ reductase (see paper)
36% identity, 68% coverage: 131:412/413 of query aligns to 12:308/309 of 5vw2A
- active site: Y86 (= Y204), S87 (= S205), F266 (≠ V370), C267 (= C371), E307 (= E411)
- binding dihydroflavine-adenine dinucleotide: R84 (= R202), L85 (≠ Q203), Y86 (= Y204), S87 (= S205), C105 (≠ T223), A109 (≠ V227), Y111 (≠ Q229), K123 (≠ I235), G125 (= G237), V126 (= V238), C127 (= C239), S128 (= S240), T168 (= T279)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S87 (= S205), R107 (≠ K225), T166 (= T277), G167 (= G278), T168 (= T279), G169 (= G280), G199 (= G308), V200 (≠ A309), A201 (≠ R310), S230 (= S336), R231 (= R337), K240 (= K343), Y242 (= Y345), Q244 (= Q347), G268 (= G372), L269 (= L373), G271 (= G375), M272 (= M376), E307 (= E411), V308 (≠ T412)
Sites not aligning to the query:
P53991 Ferredoxin--NADP reductase, chloroplastic; FNR; EC 1.18.1.2 from Chlamydomonas reinhardtii (Chlamydomonas smithii)
32% identity, 67% coverage: 137:413/413 of query aligns to 63:354/354 of P53991
- K118 (≠ S193) modified: N6,N6,N6-trimethyllysine
- K124 (vs. gap) modified: N6,N6,N6-trimethyllysine
- K170 (≠ D236) modified: N6,N6-dimethyllysine
Sites not aligning to the query:
- 1:35 modified: transit peptide, Chloroplast
2rc6A Refined structure of fnr from leptospira interrogans bound to NADP+ (see paper)
32% identity, 68% coverage: 134:413/413 of query aligns to 4:306/306 of 2rc6A
- active site: Y90 (= Y204), S91 (= S205), C264 (= C371), E304 (= E411), Y306 (= Y413)
- binding flavin-adenine dinucleotide: R88 (= R202), L89 (≠ Q203), Y90 (= Y204), S91 (= S205), I109 (≠ T223), I110 (≠ V224), D113 (≠ V227), I115 (≠ Q229), F122 (≠ I235), G124 (= G237), V125 (= V238), C126 (= C239), S127 (= S240), T167 (= T279), E304 (= E411), Y306 (= Y413)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: K111 (= K225), T165 (= T277), G166 (= G278), A197 (= A309), P198 (≠ R310), S226 (= S336), R227 (= R337), R237 (≠ K343), Y239 (= Y345), P267 (vs. gap), M270 (= M376)
- binding zinc ion: E181 (≠ R293), H216 (≠ F328)
Query Sequence
>H281DRAFT_00375 FitnessBrowser__Burk376:H281DRAFT_00375
MNGPVSIEVLRQHLIDPEICIRCNTCEETCPIDAITHDENNYVVKADVCNGCMACVPPCP
TGAIDNWRTVLKADAYPVEEQFTWDVLPEQNTMAAPAVEESPAADTTGDAAANASGIEVD
TVRGSVVPPWSAAKPYVNLYTHKTPTTATVVGNYRLTDVSTESDIHHIVLDFGTMPFPVL
EGQSIGILPPGASADGRVHHARQYSIASPRDGERPGYNNVSLTVKRVAQRHGDSIDGVCS
NYLCDLKKGDVVTVIGPFGSTFLMPNHPNSHLLMICTGTGSAPMRAMTEYRRRRRLKGAT
GKLMLFFGARTKEELPYFGPLTNLPKDFIDTNLAFSRTPGQPKRYVQDAMRERAVDVSQM
LKDDNTHIYVCGLKGMEDGVLQALKEIGEQHQLDWEALWAKLKKEGRLHLETY
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory