Comparing H281DRAFT_00382 FitnessBrowser__Burk376:H281DRAFT_00382 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2ylnA Crystal structure of the l-cystine solute receptor of neisseria gonorrhoeae in the closed conformation (see paper)
45% identity, 90% coverage: 27:259/260 of query aligns to 7:238/240 of 2ylnA
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
43% identity, 85% coverage: 34:255/260 of query aligns to 4:226/226 of 4zv1A
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
43% identity, 86% coverage: 34:256/260 of query aligns to 4:225/225 of 4zv2A
8gu1A Crystal structure of putative amino acid binding periplasmic abc transporter protein from candidatus liberibacter asiaticus in complex with pimozide (see paper)
38% identity, 86% coverage: 36:258/260 of query aligns to 3:225/234 of 8gu1A
6aalA Crystal structure of putative amino acid binding periplasmic abc transporter protein from candidatus liberibacter asiaticus in complex with arginine (see paper)
38% identity, 86% coverage: 36:258/260 of query aligns to 3:225/234 of 6aalA
6a80A Crystal structure of putative amino acid binding periplasmic abc transporter protein from candidatus liberibacter asiaticus in complex with cystine (see paper)
38% identity, 86% coverage: 36:258/260 of query aligns to 3:225/234 of 6a80A
8gtuA Crystal structure of putative amino acid binding periplasmic abc transporter protein from candidatus liberibacter asiaticus in complex with clidinium (see paper)
38% identity, 86% coverage: 36:258/260 of query aligns to 5:227/236 of 8gtuA
5t0wA Crystal structure of the ancestral amino acid-binding protein anccdt- 1, a precursor of cyclohexadienyl dehydratase
35% identity, 88% coverage: 27:254/260 of query aligns to 3:228/229 of 5t0wA
3vv5A Crystal structure of ttc0807 complexed with (s)-2-aminoethyl-l- cysteine (aec) (see paper)
35% identity, 91% coverage: 22:258/260 of query aligns to 1:234/237 of 3vv5A
3vvfA Crystal structure of ttc0807 complexed with arginine (see paper)
35% identity, 91% coverage: 22:258/260 of query aligns to 5:238/241 of 3vvfA
3vveA Crystal structure of ttc0807 complexed with lysine (see paper)
35% identity, 91% coverage: 22:258/260 of query aligns to 5:238/241 of 3vveA
3vvdA Crystal structure of ttc0807 complexed with ornithine (see paper)
35% identity, 91% coverage: 22:258/260 of query aligns to 5:238/241 of 3vvdA
6svfA Crystal structure of the p235gk mutant of argbp from t. Maritima (see paper)
33% identity, 88% coverage: 29:256/260 of query aligns to 5:229/229 of 6svfA
P0AEU0 Histidine-binding periplasmic protein; HBP from Escherichia coli (strain K12) (see 3 papers)
33% identity, 85% coverage: 37:258/260 of query aligns to 29:257/260 of P0AEU0
Sites not aligning to the query:
P02910 Histidine-binding periplasmic protein; HBP from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 2 papers)
32% identity, 85% coverage: 37:258/260 of query aligns to 29:257/260 of P02910
Sites not aligning to the query:
1hslA Refined 1.89 angstroms structure of the histidine-binding protein complexed with histidine and its relationship with many other active transport(slash)chemosensory receptors (see paper)
32% identity, 85% coverage: 37:258/260 of query aligns to 7:235/238 of 1hslA
5owfA Structure of a lao-binding protein mutant with glutamine (see paper)
32% identity, 84% coverage: 37:254/260 of query aligns to 4:228/235 of 5owfA
P02911 Lysine/arginine/ornithine-binding periplasmic protein; LAO-binding protein from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 4 papers)
32% identity, 84% coverage: 37:254/260 of query aligns to 29:253/260 of P02911
1lstA Three-dimensional structures of the periplasmic lysine-, arginine-, ornithine-binding protein with and without a ligand (see paper)
32% identity, 84% coverage: 37:254/260 of query aligns to 7:231/238 of 1lstA
1lahE Structural bases for multiple ligand specificity of the periplasmic lysine-, arginine-, ornithine-binding protein (see paper)
32% identity, 84% coverage: 37:254/260 of query aligns to 7:231/238 of 1lahE
>H281DRAFT_00382 FitnessBrowser__Burk376:H281DRAFT_00382
MKSIRSIVLIALFHAVTVSPVFAADELAQIKSSGVFRIGTEGTYAPFTYHDESGKLTGFD
VEVGTQIAQRLGVKPQFIEGKWDGLIAGLDVNRYDAVINEVAVTDARKLKYDFSDPYITS
HAALIVRSDNNAIKTFDDLKGKKSANTLTSNFGKIAAAHGAEVIPVQGFNESIDLLTAGR
VDATVNDSLSFLDFKKHKPDAKVKIAALDTSPESSDKSAVLIRKGSPELVAAINKALADM
KKDGTYAKISQKYFGKDVSK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory