Comparing H281DRAFT_00428 FitnessBrowser__Burk376:H281DRAFT_00428 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4rxtA Crystal structure of carbohydrate transporter solute binding protein arad_9553 from agrobacterium radiobacter, target efi-511541, in complex with d-arabinose
35% identity, 91% coverage: 27:311/313 of query aligns to 4:294/295 of 4rxtA
4wutA Crystal structure of an abc transporter solute binding protein (ipr025997) from agrobacterium vitis (avi_5133, target efi-511220) with bound d-fucose
32% identity, 90% coverage: 30:312/313 of query aligns to 3:290/290 of 4wutA
5dkvA Crystal structure of an abc transporter solute binding protein from agrobacterium vitis(avis_5339, target efi-511225) bound with alpha-d- tagatopyranose
35% identity, 76% coverage: 74:312/313 of query aligns to 52:301/303 of 5dkvA
Sites not aligning to the query:
5dteB Crystal structure of an abc transporter periplasmic solute binding protein (ipr025997) from actinobacillus succinogenes 130z(asuc_0081, target efi-511065) with bound d-allose
27% identity, 84% coverage: 26:287/313 of query aligns to 1:269/287 of 5dteB
2ioyA Crystal structure of thermoanaerobacter tengcongensis ribose binding protein (see paper)
28% identity, 87% coverage: 30:302/313 of query aligns to 3:273/274 of 2ioyA
7e7mC Crystal structure analysis of the streptococcus agalactiae ribose binding protein rbsb
30% identity, 84% coverage: 41:302/313 of query aligns to 22:279/284 of 7e7mC
Sites not aligning to the query:
3ksmA Crystal structure of abc-type sugar transport system, periplasmic component from hahella chejuensis
28% identity, 84% coverage: 32:293/313 of query aligns to 5:270/276 of 3ksmA
5hqjA Crystal structure of abc transporter solute binding protein b1g1h7 from burkholderia graminis c4d1m, target efi-511179, in complex with d-arabinose
25% identity, 84% coverage: 41:303/313 of query aligns to 19:285/289 of 5hqjA
Sites not aligning to the query:
8wlbA X-ray structure of enterobacter cloacae allose-binding protein in complex with d-psicose (see paper)
28% identity, 82% coverage: 32:288/313 of query aligns to 6:277/288 of 8wlbA
8wl9A X-ray structure of enterobacter cloacae allose-binding protein in complex with d-ribose (see paper)
28% identity, 82% coverage: 32:288/313 of query aligns to 6:277/288 of 8wl9A
1rpjA Crystal structure of d-allose binding protein from escherichia coli (see paper)
28% identity, 78% coverage: 32:276/313 of query aligns to 6:263/288 of 1rpjA
1gudA Hinge-bending motion of d-allose binding protein from escherichia coli: three open conformations (see paper)
28% identity, 78% coverage: 32:276/313 of query aligns to 6:263/288 of 1gudA
Sites not aligning to the query:
7x0hA Crystal structure of sugar binding protein cbpa complexed wtih glucose from clostridium thermocellum (see paper)
26% identity, 89% coverage: 25:304/313 of query aligns to 7:284/287 of 7x0hA
6guqA Crystal structure of ganp, a glucose-galactose binding protein from geobacillus stearothermophilus, in complex with glucose
24% identity, 83% coverage: 32:292/313 of query aligns to 6:266/278 of 6guqA
5xssA Xylfii molecule (see paper)
27% identity, 81% coverage: 30:284/313 of query aligns to 6:260/274 of 5xssA
6gt9A Crystal structure of ganp, a glucose-galactose binding protein from geobacillus stearothermophilus, in complex with galactose
24% identity, 83% coverage: 32:292/313 of query aligns to 11:271/283 of 6gt9A
2h3hA Crystal structure of the liganded form of thermotoga maritima glucose binding protein (see paper)
25% identity, 75% coverage: 39:274/313 of query aligns to 12:246/313 of 2h3hA
Sites not aligning to the query:
3c6qC Apo and ligand-bound form of a thermophilic glucose/xylose binding protein
25% identity, 74% coverage: 39:270/313 of query aligns to 12:242/305 of 3c6qC
Sites not aligning to the query:
5ibqA Crystal structure of an abc solute binding protein from rhizobium etli cfn 42 (rhe_pf00037,target efi-511357) in complex with alpha-d-apiose
24% identity, 83% coverage: 30:289/313 of query aligns to 5:263/287 of 5ibqA
4ry0A Crystal structure of ribose transporter solute binding protein rhe_pf00037 from rhizobium etli cfn 42, target efi-511357, in complex with d-ribose
24% identity, 83% coverage: 30:289/313 of query aligns to 5:263/287 of 4ry0A
>H281DRAFT_00428 FitnessBrowser__Burk376:H281DRAFT_00428
MLNRKLFGVVIGVGALVGGANLAHADEVYIPLISKGFQHQFWQAVKAGAEQGAKEHKVRI
TFEGPETEAMVDKQIDMLSAALAKKPQALGIAALDSKAAIPLLRRAQAAKIPVIAFDSGV
DSDIPLTTCSTDNLAAAALAADKMAEAIGNAGEVGVIVHDQTSRTGIDRRDGFLNEMKSK
HPNVKIVSVQYGGGDHLKSAEIAKAMIQANPNIKGIFGANEGSAEGAAIGVKESGKKLVL
IGYDSGKEQKDDINSGLMAGAITQNPIGIGKCVVDSAVKALKGEKLPKKVDTGFYWYDKS
NMNDPKIAAVLYD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory