Comparing H281DRAFT_00442 FitnessBrowser__Burk376:H281DRAFT_00442 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 10 hits to proteins with known functional sites (download)
P25297 Inorganic phosphate transporter PHO84 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
25% identity, 74% coverage: 89:451/489 of query aligns to 117:550/587 of P25297
Sites not aligning to the query:
A0A0H2VG78 Glucose transporter GlcP; Glucose/H(+) symporter from Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) (see paper)
24% identity, 62% coverage: 95:395/489 of query aligns to 63:375/446 of A0A0H2VG78
Sites not aligning to the query:
Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
24% identity, 53% coverage: 47:306/489 of query aligns to 56:294/444 of Q8NLB7
Sites not aligning to the query:
6m20B Crystal structure of plasmodium falciparum hexose transporter pfht1 bound with glucose (see paper)
24% identity, 53% coverage: 138:396/489 of query aligns to 109:410/478 of 6m20B
Q9Y7Q9 Probable metabolite transporter C2H8.02 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
28% identity, 33% coverage: 81:242/489 of query aligns to 90:258/583 of Q9Y7Q9
Sites not aligning to the query:
6rw3A The molecular basis for sugar import in malaria parasites. (see paper)
24% identity, 52% coverage: 138:392/489 of query aligns to 99:381/437 of 6rw3A
6m2lA Crystal structure of plasmodium falciparum hexose transporter pfht1 bound with c3361 (see paper)
24% identity, 52% coverage: 138:392/489 of query aligns to 99:381/447 of 6m2lA
Sites not aligning to the query:
8fvzA Pipt y150a
26% identity, 34% coverage: 40:206/489 of query aligns to 11:182/433 of 8fvzA
Sites not aligning to the query:
O42885 Putative inorganic phosphate transporter C8E4.01c from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
26% identity, 35% coverage: 81:251/489 of query aligns to 100:276/572 of O42885
Sites not aligning to the query:
Q09852 Putative inorganic phosphate transporter C23D3.12 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
25% identity, 37% coverage: 81:261/489 of query aligns to 95:289/559 of Q09852
Sites not aligning to the query:
>H281DRAFT_00442 FitnessBrowser__Burk376:H281DRAFT_00442
LTASSNGFWRHHKQEQRLSLDDITVVDNSLLKRAVGAMALGNAMEWFDFGVYSYIAVTLG
KVFFPSSSPSAQLIATFGTFAAAFLVRPVGGMVFGPLGDRIGRQRVLAMTMIMMAIGTFA
IGLIPSYGSIGILAPALLLVARLVQGFSTGGEYGGAATFIAEFSTDKRRGFMGSFLEFGT
LIGYVLGAGTVAVLTATLSNDALLSWGWRVPFLIAGPLGLVGLYIRMKLEETPAFKKQAE
QREAEDKAVPKQSLRNLLMQQWKPLLLCVGLVLIFNVTDYMALSYLPSYLSATLHFNESH
GLFIVLLVMVLMMPMTLAAGRLSDTIGRKPVMLFGCVGLFALSIPALLLIRMGTLVPVFG
GLMILGVLLSCFTGVMPSALPALFPTKIRYGALAIGFNISVSLFGGTTPLVTAWLVDRTG
NLMMPAYYLMGASLIGIVSVMALRETARKPLLGSGPCVATRAEAHAVLRGEREAEEMDER
YAATATARA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory