Comparing H281DRAFT_00563 FitnessBrowser__Burk376:H281DRAFT_00563 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0AAH4 Putrescine export system ATP-binding protein SapD from Escherichia coli (strain K12) (see paper)
37% identity, 51% coverage: 25:309/554 of query aligns to 1:299/330 of P0AAH4
7z15I E. Coli c-p lyase bound to a phnk/phnl dual abc dimer and adp + pi (see paper)
38% identity, 42% coverage: 321:552/554 of query aligns to 17:248/253 of 7z15I
Sites not aligning to the query:
7z18I E. Coli c-p lyase bound to a phnk abc dimer and atp (see paper)
38% identity, 42% coverage: 321:552/554 of query aligns to 17:248/250 of 7z18I
Sites not aligning to the query:
7z16I E. Coli c-p lyase bound to phnk/phnl dual abc dimer with amppnp and phnk e171q mutation (see paper)
38% identity, 42% coverage: 321:552/554 of query aligns to 17:248/250 of 7z16I
Sites not aligning to the query:
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
37% identity, 43% coverage: 42:278/554 of query aligns to 20:243/343 of P30750
Sites not aligning to the query:
Q8RDH4 Dipeptide transport ATP-binding protein DppD; EC 7.4.2.9 from Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) (Thermoanaerobacter tengcongensis) (see paper)
36% identity, 44% coverage: 38:278/554 of query aligns to 19:257/326 of Q8RDH4
Sites not aligning to the query:
4fwiB Crystal structure of the nucleotide-binding domain of a dipeptide abc transporter (see paper)
36% identity, 44% coverage: 38:278/554 of query aligns to 18:256/310 of 4fwiB
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
36% identity, 43% coverage: 42:278/554 of query aligns to 21:244/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
36% identity, 43% coverage: 42:278/554 of query aligns to 21:244/344 of 3tuiC
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
36% identity, 43% coverage: 42:278/554 of query aligns to 21:244/344 of 6cvlD
Sites not aligning to the query:
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
36% identity, 45% coverage: 26:277/554 of query aligns to 1:237/241 of 4u00A
3c4jA Abc protein artp in complex with atp-gamma-s
33% identity, 45% coverage: 27:276/554 of query aligns to 3:238/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
33% identity, 45% coverage: 27:276/554 of query aligns to 3:238/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
33% identity, 45% coverage: 27:276/554 of query aligns to 3:238/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
33% identity, 45% coverage: 27:276/554 of query aligns to 3:238/242 of 2oljA
1oxvD Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
34% identity, 41% coverage: 315:539/554 of query aligns to 13:232/353 of 1oxvD
1oxvA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
34% identity, 41% coverage: 315:539/554 of query aligns to 13:232/353 of 1oxvA
1oxuA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
34% identity, 41% coverage: 315:539/554 of query aligns to 13:232/353 of 1oxuA
Q97UY8 Glucose import ATP-binding protein GlcV; EC 7.5.2.- from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
34% identity, 41% coverage: 315:539/554 of query aligns to 13:232/353 of Q97UY8
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
33% identity, 45% coverage: 38:288/554 of query aligns to 37:275/382 of 7ahhC
Sites not aligning to the query:
>H281DRAFT_00563 FitnessBrowser__Burk376:H281DRAFT_00563
VTAQTQAPGQRKGRGDDGAEAPNAVPLLELDHLHVSFGDTVAVNDVTLAIQRGERVALVG
ESGSGKSVTALSILRLLSDAQVSGSIRFDGEDLLAKSEREMRGMRGSDIAMIFQEPMTAL
NPLYTVGAQIAETIVVHDGVSPAEARKRAVALLGRTGIPEPGKRVNSYPHQLSGGQRQRA
MIAMALACRPRLLLADEPTTALDVTIRAQIVELLLELQRDEAQKRGMAVLLITHDLNLVR
HFAQRIAVMEKGVLVESGPVEQVFESPQHPYTQRLLESRPQRSVVPVLPISPVLLQARDV
SVDFKTKVPGFAGWFRAGRFRAVANASVSVRQGETLGIVGESGSGKSTLAMALLGLQRTA
HGEIEFQGRALSTYRGAQQTALRSNMQVVFQDPFSSLSPRQTIERIVGEGLALHRPQMTP
QARRDRVVAVLREVGIDRTALLRYPHEFSGGQRQRIAIARALVVEPQILILDEPTSALDV
SIQQQVLKLLAGLQQKYNLGFVFISHDLAVIGAMAHRVAVMQNGSIVESGEVERIFATPE
HPYTRKLLKAALDR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory