Comparing H281DRAFT_00576 FitnessBrowser__Burk376:H281DRAFT_00576 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
3cuxA Atomic resolution structures of escherichia coli and bacillis anthracis malate synthase a: comparison with isoform g and implications for structure based drug design (see paper)
58% identity, 95% coverage: 23:531/533 of query aligns to 9:499/501 of 3cuxA
P30952 Malate synthase 1; EC 2.3.3.9 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
52% identity, 95% coverage: 27:533/533 of query aligns to 31:541/554 of P30952
Sites not aligning to the query:
3cv2A Atomic resolution structures of escherichia coli and bacillis anthracis malate synthase a: comparison with isoform g and implications for structure based drug design (see paper)
50% identity, 95% coverage: 27:530/533 of query aligns to 15:520/524 of 3cv2A
3cv1A Atomic resolution structures of escherichia coli and bacillis anthracis malate synthase a: comparison with isoform g and implications for structure based drug design (see paper)
50% identity, 95% coverage: 27:530/533 of query aligns to 20:525/529 of 3cv1A
3cuzA Atomic resolution structures of escherichia coli and bacillis anthracis malate synthase a: comparison with isoform g and implications for structure based drug design (see paper)
50% identity, 95% coverage: 27:530/533 of query aligns to 20:525/529 of 3cuzA
5cahA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 6h-thieno[2,3-b]pyrrole-5-carboxylic acid (see paper)
23% identity, 69% coverage: 99:466/533 of query aligns to 245:628/706 of 5cahA
>H281DRAFT_00576 FitnessBrowser__Burk376:H281DRAFT_00576
MANPLSSLSLPQGMEITAEIKPGYEAILTREALELVAALHRTFEPRRQQLLQARTERTNR
LDAGERPDFLAATKSVRDGDWTIAPLPEDLKCRRVEITGPVERKMIINALNSGADSYMTD
FEDSNAPSWDNQITGHVNLKDAVRRTISLEQNGKSYKLNDKVATLIVRPRGWHLDEKHVK
VDGKRVSGGIFDFALFMAHNAKELVARGSGPYFYLPKMESHLEARLWNDIFVAAQEAVGV
PRGTIRATVLIETILAAFEMDEILYELREHSSGLNAGRWDYIFSAIKKFKSDRDFCLADR
SQITMTAPFMRAYALLLLKTCHRRNAPAIGGMSALIPIKNDPAANDKAMAGVRSDKARDA
GDGYDGGWVAHPGLVPIAMEEFVKVLGDKPNQIGKQRVDVLVTATDLMDFRPEAPITEAG
LRNNINVGIHYLGSWLAGNGCVPIHNLMEDAATAEISRSQVWQWIRSPKGTLDDGRKVTA
ELVRELAGHELDKVKQAVGGDTKPYERAAQIFEEMSTSEQFTDFLTLPLYEEI
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory