Comparing H281DRAFT_00600 FitnessBrowser__Burk376:H281DRAFT_00600 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3jtxB Crystal structure of aminotransferase (np_283882.1) from neisseria meningitidis z2491 at 1.91 a resolution
53% identity, 99% coverage: 1:401/405 of query aligns to 1:393/393 of 3jtxB
1gdeA Crystal structure of pyrococcus protein a-1 e-form (see paper)
30% identity, 97% coverage: 4:396/405 of query aligns to 2:378/388 of 1gdeA
1gd9A Crystall structure of pyrococcus protein-a1 (see paper)
30% identity, 97% coverage: 4:396/405 of query aligns to 2:378/388 of 1gd9A
1j32A Aspartate aminotransferase from phormidium lapideum
27% identity, 93% coverage: 26:403/405 of query aligns to 27:387/388 of 1j32A
P14909 Aspartate aminotransferase; AspAT; Transaminase A; EC 2.6.1.1 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see 3 papers)
24% identity, 96% coverage: 17:403/405 of query aligns to 23:398/402 of P14909
Sites not aligning to the query:
1o4sB Crystal structure of aspartate aminotransferase (tm1255) from thermotoga maritima at 1.90 a resolution (see paper)
28% identity, 95% coverage: 15:400/405 of query aligns to 28:382/384 of 1o4sB
2x5dD Crystal structure of a probable aminotransferase from pseudomonas aeruginosa (see paper)
27% identity, 96% coverage: 15:401/405 of query aligns to 3:376/380 of 2x5dD
6l1nA Substrate bound bacf structure from bacillus subtillis (see paper)
26% identity, 97% coverage: 6:396/405 of query aligns to 7:383/393 of 6l1nA
6l1oB Product bound bacf structure from bacillus subtillis (see paper)
26% identity, 97% coverage: 6:396/405 of query aligns to 7:384/392 of 6l1oB
6l1lB Apo-bacf structure from bacillus subtillis (see paper)
26% identity, 97% coverage: 6:396/405 of query aligns to 7:384/393 of 6l1lB
8wkjA The crystal structure of aspartate aminotransferases lpg0070 from legionella pneumophila (see paper)
25% identity, 92% coverage: 28:400/405 of query aligns to 30:390/391 of 8wkjA
2o1bA Structure of aminotransferase from staphylococcus aureus
26% identity, 92% coverage: 29:400/405 of query aligns to 19:372/376 of 2o1bA
P58350 Aspartate aminotransferase; AAT; AspAT; Putative 2-aminoadipate transaminase; Transaminase A; EC 2.6.1.1; EC 2.6.1.39 from Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
26% identity, 93% coverage: 28:404/405 of query aligns to 40:410/410 of P58350
6f35A Crystal structure of the aspartate aminotranferase from rhizobium meliloti (see paper)
26% identity, 93% coverage: 28:404/405 of query aligns to 30:400/400 of 6f35A
1b5oA Thermus thermophilus aspartate aminotransferase single mutant 1 (see paper)
28% identity, 84% coverage: 28:369/405 of query aligns to 30:359/382 of 1b5oA
1gc4A Thermus thermophilus aspartate aminotransferase tetra mutant 2 complexed with aspartate (see paper)
28% identity, 84% coverage: 28:369/405 of query aligns to 30:359/382 of 1gc4A
Sites not aligning to the query:
1gc3A Thermus thermophilus aspartate aminotransferase tetra mutant 2 complexed with tryptophan (see paper)
28% identity, 84% coverage: 28:369/405 of query aligns to 30:359/382 of 1gc3A
Sites not aligning to the query:
Q56232 Aspartate/prephenate aminotransferase; AspAT / PAT; Transaminase A; EC 2.6.1.1; EC 2.6.1.78 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see 3 papers)
28% identity, 84% coverage: 28:369/405 of query aligns to 30:359/385 of Q56232
Sites not aligning to the query:
1bkgA Aspartate aminotransferase from thermus thermophilus with maleate (see paper)
28% identity, 84% coverage: 28:369/405 of query aligns to 30:359/382 of 1bkgA
1bjwA Aspartate aminotransferase from thermus thermophilus (see paper)
28% identity, 84% coverage: 28:369/405 of query aligns to 30:359/382 of 1bjwA
Sites not aligning to the query:
>H281DRAFT_00600 FitnessBrowser__Burk376:H281DRAFT_00600
VNPLLDSLQPYPFEKLRALFKDVAPAAGFPHISFGIGEPKHPTPTLITDAVIASLGGLSA
YPATVGSLPLRESIAKWVTQRYGLPPVDPATQVLPVSGSREALFALAQTVIDPRRNAKGE
PAIVLCPNPFYQIYEGAAILAGAEPYFVNSDPARNFACDYSAVPADVWARTQLLYVCSPG
NPTGAVLTLEDWRELFALSDRHGFVIASDECYSEIYFDEANAPLGGLEAAHKLGRGYDRL
IMLSSLSKRSNVPGMRSGFVAGDAAILKDFLLYRTYHGAALSTVFQSASIAAWNDEAHVR
ENRAKYVQKFSTVTPMLAAVLDVRLPDAAFYLWADVSRTGLTDTEFAQRLYADYNVTVLP
GSFLARTAHGVNPGRNFVRLALVADVDECTQGAQRIVDFCRGLAG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory