Comparing H281DRAFT_00668 FitnessBrowser__Burk376:H281DRAFT_00668 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
7rk5B Mannitol-2-dehydrogenase bound to nadh from aspergillus fumigatus
26% identity, 59% coverage: 135:355/377 of query aligns to 169:399/501 of 7rk5B
Sites not aligning to the query:
4im7A Crystal structure of fructuronate reductase (ydfi) from e. Coli cft073 (efi target efi-506389) complexed with nadh and d-mannonate
26% identity, 57% coverage: 136:351/377 of query aligns to 152:375/483 of 4im7A
Sites not aligning to the query:
1m2wA Pseudomonas fluorescens mannitol 2-dehydrogenase ternary complex with NAD and d-mannitol (see paper)
23% identity, 72% coverage: 85:355/377 of query aligns to 101:390/492 of 1m2wA
Sites not aligning to the query:
1lj8A Crystal structure of mannitol dehydrogenase in complex with NAD (see paper)
23% identity, 72% coverage: 85:355/377 of query aligns to 101:390/492 of 1lj8A
Sites not aligning to the query:
P09424 Mannitol-1-phosphate 5-dehydrogenase; EC 1.1.1.17 from Escherichia coli (strain K12) (see paper)
25% identity, 46% coverage: 158:332/377 of query aligns to 115:286/382 of P09424
>H281DRAFT_00668 FitnessBrowser__Burk376:H281DRAFT_00668
MTNTPCPILQFGTSRFLQAHVDLFVCEAARRNPDDALGKIAMVQTTASTQSRARIDAIRA
NARYPVRIRGLHRKETVDLTIECDSVAQALHADDDWPLLLEYIRDEVKVIVSNTADNGYA
LFAEDTASVLDGRTAPRGFAAKLAVLLHERYRAGGKAITLLPCELVSRNGDVLRDLVLSV
ARGWQMDADFLRYLTNDCIWVNSLVDRIVSEAIEPVGAVAEPYALWAIEQQDGMVLPCRH
ESIVVTDNLAHYERLKLFLLNLGHTMLAQCWLDSQGDPATTVLDGMRNESWRATLESTWK
DEVLPVFEALGQSEIATKYLDDVRDRFSNPFLAHRLADIANNHQEKKQRRLKPVVELASE
LGVRVEQKHLKAALAGA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory