SitesBLAST
Comparing H281DRAFT_00756 FitnessBrowser__Burk376:H281DRAFT_00756 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3bptA Crystal structure of human beta-hydroxyisobutyryl-coa hydrolase in complex with quercetin
36% identity, 94% coverage: 8:362/376 of query aligns to 2:347/362 of 3bptA
- active site: G67 (= G73), P84 (≠ D91), R88 (≠ I95), G115 (= G122), G118 (= G125), E138 (= E149), D146 (= D157)
- binding (2r)-3-hydroxy-2-methylpropanoic acid: G66 (= G72), G67 (= G73), I69 (= I75), E90 (= E97), G114 (= G121), G115 (= G122), E138 (= E149), D146 (= D157), V147 (= V158)
- binding 3,5,7,3',4'-pentahydroxyflavone: F25 (≠ A31), L26 (= L32), A28 (= A34), G66 (= G72), G67 (= G73), I69 (= I75), P137 (= P148), I141 (= I152), L319 (≠ I334)
Q9LKJ1 3-hydroxyisobutyryl-CoA hydrolase 1; CoA-thioester hydrolase CHY1; EC 3.1.2.-; EC 3.1.2.4 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
34% identity, 91% coverage: 21:361/376 of query aligns to 19:354/378 of Q9LKJ1
- G70 (= G73) mutation to S: Loss of activity.
- E142 (= E149) mutation to A: Loss of activity.
- D150 (= D157) mutation to G: Reduced activity.
4hdtA Crystal structure of a carnitinyl-coa dehydratase from mycobacterium thermoresistibile (see paper)
37% identity, 93% coverage: 10:360/376 of query aligns to 1:328/340 of 4hdtA
- active site: G64 (= G73), I69 (≠ L78), W84 (≠ F94), Y88 (= Y98), G112 (≠ I126), G115 (= G129), E135 (= E149), P142 (= P156), D143 (= D157), R283 (= R311)
- binding zinc ion: H28 (≠ L37), E42 (≠ R51), E57 (≠ P66), E79 (= E88), H93 (≠ A103), H185 (≠ D199)
Sites not aligning to the query:
P14604 Enoyl-CoA hydratase, mitochondrial; mECH; mECH1; Enoyl-CoA hydratase 1; ECHS1; Short-chain enoyl-CoA hydratase; SCEH; EC 4.2.1.17; EC 5.3.3.8 from Rattus norvegicus (Rat) (see 3 papers)
34% identity, 46% coverage: 21:192/376 of query aligns to 47:208/290 of P14604
- E144 (≠ G125) mutation to D: Reduces activity 50-fold.; mutation to Q: Reduces activity 3300-fold.
- E164 (= E149) mutation to D: Reduces activity 1250-fold.; mutation to Q: Reduces activity 330000-fold.
Sites not aligning to the query:
- 1:29 modified: transit peptide, Mitochondrion
1ey3A Structure of enoyl-coa hydratase complexed with the substrate dac-coa (see paper)
34% identity, 46% coverage: 21:192/376 of query aligns to 15:176/258 of 1ey3A
- active site: A66 (≠ G73), M71 (≠ S81), S81 (≠ D91), L85 (≠ I95), G109 (= G122), E112 (≠ G125), P131 (= P148), E132 (= E149), T137 (≠ L154), P139 (= P156), G140 (≠ D157)
- binding 4-(n,n-dimethylamino)cinnamoyl-coa: K24 (= K30), L26 (= L32), A28 (= A34), A64 (= A71), G65 (= G72), A66 (≠ G73), D67 (= D74), I68 (= I75), L85 (≠ I95), W88 (≠ Y98), G109 (= G122), P131 (= P148), L135 (≠ I152), G140 (≠ D157)
Sites not aligning to the query:
1dubA 2-enoyl-coa hydratase, data collected at 100 k, ph 6.5 (see paper)
34% identity, 46% coverage: 21:192/376 of query aligns to 17:178/260 of 1dubA
- active site: A68 (≠ G73), M73 (≠ S81), S83 (≠ D91), L87 (≠ I95), G111 (= G122), E114 (≠ G125), P133 (= P148), E134 (= E149), T139 (≠ L154), P141 (= P156), G142 (≠ D157)
- binding acetoacetyl-coenzyme a: K26 (= K30), A27 (= A31), L28 (= L32), A30 (= A34), A66 (= A71), A68 (≠ G73), D69 (= D74), I70 (= I75), Y107 (≠ V118), G110 (= G121), G111 (= G122), E114 (≠ G125), P133 (= P148), E134 (= E149), L137 (≠ I152), G142 (≠ D157)
Sites not aligning to the query:
2dubA Enoyl-coa hydratase complexed with octanoyl-coa (see paper)
34% identity, 46% coverage: 21:192/376 of query aligns to 16:172/254 of 2dubA
- active site: A67 (≠ G73), M72 (≠ A89), S82 (≠ R99), G105 (= G122), E108 (≠ G125), P127 (= P148), E128 (= E149), T133 (≠ L154), P135 (= P156), G136 (≠ D157)
- binding octanoyl-coenzyme a: K25 (= K30), A26 (= A31), L27 (= L32), A29 (= A34), A65 (= A71), A67 (≠ G73), D68 (= D74), I69 (= I75), K70 (≠ R76), G105 (= G122), E108 (≠ G125), P127 (= P148), E128 (= E149), G136 (≠ D157), A137 (≠ V158)
Sites not aligning to the query:
2hw5C The crystal structure of human enoyl-coenzyme a (coa) hydratase short chain 1, echs1
34% identity, 46% coverage: 19:192/376 of query aligns to 15:178/260 of 2hw5C
- active site: A68 (≠ G73), M73 (≠ S81), S83 (≠ D91), L87 (≠ I95), G111 (= G122), E114 (≠ G125), P133 (= P148), E134 (= E149), T139 (≠ L154), P141 (= P156), G142 (≠ D157)
- binding crotonyl coenzyme a: K26 (= K30), A27 (= A31), L28 (= L32), A30 (= A34), K62 (≠ R67), I70 (= I75), F109 (≠ M120)
Sites not aligning to the query:
1mj3A Crystal structure analysis of rat enoyl-coa hydratase in complex with hexadienoyl-coa (see paper)
34% identity, 46% coverage: 21:192/376 of query aligns to 17:176/258 of 1mj3A
- active site: A68 (≠ G73), M73 (≠ A89), S83 (≠ R99), L85 (= L100), G109 (= G122), E112 (≠ G125), P131 (= P148), E132 (= E149), T137 (≠ L154), P139 (= P156), G140 (≠ D157)
- binding hexanoyl-coenzyme a: K26 (= K30), A27 (= A31), L28 (= L32), A30 (= A34), A66 (= A71), G67 (= G72), A68 (≠ G73), D69 (= D74), I70 (= I75), G109 (= G122), P131 (= P148), E132 (= E149), L135 (≠ I152), G140 (≠ D157)
Sites not aligning to the query:
3q0gD Crystal structure of the mycobacterium tuberculosis crotonase bound to a reaction intermediate derived from crotonyl coa
28% identity, 46% coverage: 21:192/376 of query aligns to 13:170/250 of 3q0gD
- active site: A64 (≠ G73), M69 (≠ L78), T75 (≠ F94), F79 (≠ Y98), G103 (= G122), E106 (≠ G125), P125 (= P148), E126 (= E149), V131 (≠ L154), P133 (= P156), G134 (≠ D157)
Sites not aligning to the query:
6z1pBI mS93 (see paper)
31% identity, 43% coverage: 33:193/376 of query aligns to 44:201/1413 of 6z1pBI
- active site: T85 (≠ G73), S134 (≠ G122), E157 (= E149), D165 (= D157)
- binding : T45 (≠ A34), D47 (≠ S36), H49 (≠ G38), K83 (≠ A71), T85 (≠ G73), D86 (= D74), F87 (≠ I75), K88 (≠ R76), K92 (≠ E80), L130 (≠ V118), K152 (= K144)
Sites not aligning to the query:
- binding : 4, 5, 12, 14, 41, 42, 43, 427, 731, 733, 734
5zaiC Crystal structure of 3-hydroxypropionyl-coa dehydratase from metallosphaera sedula (see paper)
26% identity, 48% coverage: 23:202/376 of query aligns to 16:187/259 of 5zaiC
- active site: A65 (≠ G73), F70 (≠ L78), S82 (≠ A82), R86 (≠ E86), G110 (= G122), E113 (≠ G125), P132 (= P148), E133 (= E149), I138 (≠ L154), P140 (= P156), G141 (≠ D157)
- binding coenzyme a: K24 (≠ A31), L25 (= L32), A63 (= A71), G64 (= G72), A65 (≠ G73), D66 (= D74), I67 (= I75), P132 (= P148), R166 (≠ A181)
Sites not aligning to the query:
3q0jC Crystal structure of the mycobacterium tuberculosis crotonase in complex with the inhibitor acetoacetylcoa
28% identity, 46% coverage: 21:192/376 of query aligns to 14:175/255 of 3q0jC
- active site: A65 (≠ G73), M70 (≠ R84), T80 (≠ F94), F84 (≠ Y98), G108 (= G122), E111 (≠ G125), P130 (= P148), E131 (= E149), V136 (≠ L154), P138 (= P156), G139 (≠ D157)
- binding acetoacetyl-coenzyme a: Q23 (≠ K30), A24 (= A31), L25 (= L32), A27 (= A34), A63 (= A71), G64 (= G72), A65 (≠ G73), D66 (= D74), I67 (= I75), K68 (≠ R76), M70 (≠ R84), F84 (≠ Y98), G107 (= G121), G108 (= G122), E111 (≠ G125), P130 (= P148), E131 (= E149), P138 (= P156), G139 (≠ D157), M140 (≠ V158)
Sites not aligning to the query:
3q0gC Crystal structure of the mycobacterium tuberculosis crotonase bound to a reaction intermediate derived from crotonyl coa
28% identity, 46% coverage: 21:192/376 of query aligns to 14:175/255 of 3q0gC
- active site: A65 (≠ G73), M70 (≠ R84), T80 (≠ F94), F84 (≠ Y98), G108 (= G122), E111 (≠ G125), P130 (= P148), E131 (= E149), V136 (≠ L154), P138 (= P156), G139 (≠ D157)
- binding coenzyme a: L25 (= L32), A63 (= A71), I67 (= I75), K68 (≠ R76), Y104 (≠ V118), P130 (= P148), E131 (= E149), L134 (≠ I152)
Sites not aligning to the query:
3h81A Crystal structure of enoyl-coa hydratase from mycobacterium tuberculosis (see paper)
28% identity, 46% coverage: 21:192/376 of query aligns to 13:174/256 of 3h81A
- active site: A64 (≠ G73), M69 (≠ R84), T79 (≠ F94), F83 (≠ Y98), G107 (= G122), E110 (≠ G125), P129 (= P148), E130 (= E149), V135 (≠ L154), P137 (= P156), G138 (≠ D157)
Sites not aligning to the query:
5jbxB Crystal structure of liuc in complex with coenzyme a and malonic acid (see paper)
32% identity, 43% coverage: 33:194/376 of query aligns to 27:181/261 of 5jbxB
- active site: A67 (≠ G73), R72 (≠ S81), L84 (≠ F94), R88 (≠ Y98), G112 (= G122), E115 (≠ G125), T134 (≠ P148), E135 (= E149), I140 (≠ L154), P142 (= P156), G143 (≠ D157)
- binding coenzyme a: A28 (= A34), A65 (= A71), D68 (= D74), L69 (≠ I75), K70 (≠ R76), L110 (≠ M120), G111 (= G121), T134 (≠ P148), E135 (= E149), L138 (≠ I152), R168 (≠ A181)
Sites not aligning to the query:
6yswA E. Coli anaerobic trifunctional enzyme subunit-alpha in complex with coenzyme a
29% identity, 46% coverage: 21:194/376 of query aligns to 13:183/707 of 6yswA
- active site: A66 (≠ G73), I71 (≠ L78), A84 (= A89), Q88 (≠ Y98), G112 (= G122), E115 (≠ G125), P136 (= P148), E137 (= E149), G145 (≠ D157)
- binding coenzyme a: E23 (≠ K30), M25 (≠ L32), A66 (≠ G73), D67 (= D74), I68 (= I75), P136 (= P148), E137 (= E149), L140 (≠ I152)
Sites not aligning to the query:
6slbAAA Enoyl-CoA hydratase/carnithine racemase (see paper)
31% identity, 45% coverage: 24:192/376 of query aligns to 16:175/257 of 6slbAAA
- active site: Q64 (≠ G73), F69 (≠ L78), L80 (≠ I95), N84 (vs. gap), A108 (≠ G122), S111 (≠ G125), A130 (≠ P148), F131 (≠ E149), L136 (= L154), P138 (= P156), D139 (= D157)
- binding (~{E})-6-[2-[3-[[(2~{R})-4-[[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,3-dimethyl-2-oxidanyl-butanoyl]amino]propanoylamino]ethylsulfanyl]-6-oxidanylidene-hex-3-enoic acid: R58 (= R67), A62 (= A71), Q64 (≠ G73), D65 (= D74), L66 (≠ I75), Y76 (≠ H87), A108 (≠ G122), F131 (≠ E149), D139 (= D157)
Sites not aligning to the query:
3p85A Crystal structure enoyl-coa hydratase from mycobacterium avium (see paper)
29% identity, 45% coverage: 24:192/376 of query aligns to 14:159/224 of 3p85A
- active site: L62 (≠ G73), L67 (= L78), P68 (≠ Y79), G92 (= G122), E95 (≠ G125), T114 (≠ P148), H115 (≠ E149), L120 (= L154), P122 (= P156), T123 (≠ D157)
- binding calcium ion: D43 (≠ N53), D45 (= D55)
Sites not aligning to the query:
O53561 Enoyl-CoA hydratase EchA19; EC 4.2.1.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
29% identity, 57% coverage: 23:238/376 of query aligns to 20:230/266 of O53561
- K135 (= K144) modified: N6-succinyllysine; mutation to E: Nearly wild-type levels of succinylation in vitro, reduces specific activity 8-fold.
- 135:142 (vs. 144:151, 25% identical) mutation to EFGISEAE: Very low levels of succinylation in vitro, reduces specific activity 15-fold.
- K142 (≠ R151) modified: N6-succinyllysine; mutation to E: About 50% succinylation in vitro, reduces specific activity 7-fold.
Query Sequence
>H281DRAFT_00756 FitnessBrowser__Burk376:H281DRAFT_00756
MSLSALPEASDEVATYVANCIGFIELERPKALNALSLGMIRAIHAALDDWRENPDVLAVV
VRSQHPRAFCAGGDIRFLYESAKRGEHEARDAFFIEEYRLNHAIFTYPKPYIALTNGVVM
GGGMGISQGAHRTGGLRVVTQSTKMAMPETRIGLFPDVGASWFLARTPGAIGRYLAVTGE
AIGAADALYAGLADLYIDDAALPALIDILRSELFERGADVVACVERESRAYQVAPQPEQS
PLARARRLIDRHFALPDVPRILASLQQKCDRDTADWAEQTIAVLRERSPLSMAVSLEVVT
RAEGSMAEVLRGDLDLTRSSFLQGDAVEGIRARIIDKDNAPHWRFARIEDVSAADVAKMF
ESPWPAYEHPLRDLHG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory