Comparing H281DRAFT_00811 FitnessBrowser__Burk376:H281DRAFT_00811 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
4f4fA X-ray crystal structure of plp bound threonine synthase from brucella melitensis
42% identity, 99% coverage: 1:477/483 of query aligns to 2:458/464 of 4f4fA
Q42598 Threonine synthase; TS; EC 4.2.3.1 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
39% identity, 92% coverage: 1:443/483 of query aligns to 5:463/514 of Q42598
1kl7A Crystal structure of threonine synthase from yeast (see paper)
40% identity, 91% coverage: 3:443/483 of query aligns to 7:460/509 of 1kl7A
8g1yA Crystal structure of the threonine synthase from streptococcus pneumoniae in complex with pyridoxal 5-phosphate.
34% identity, 96% coverage: 3:465/483 of query aligns to 7:458/496 of 8g1yA
1vb3A Crystal structure of threonine synthase from escherichia coli
29% identity, 96% coverage: 13:478/483 of query aligns to 11:425/428 of 1vb3A
6cgqB Threonine synthase from bacillus subtilis atcc 6633 with plp and plp- ala (see paper)
29% identity, 38% coverage: 93:277/483 of query aligns to 25:191/345 of 6cgqB
Sites not aligning to the query:
6nmxA Threonine synthase from bacillus subtilis atcc 6633 with plp and appa (see paper)
29% identity, 38% coverage: 93:277/483 of query aligns to 27:193/350 of 6nmxA
Sites not aligning to the query:
2d1fA Structure of mycobacterium tuberculosis threonine synthase (see paper)
27% identity, 38% coverage: 93:277/483 of query aligns to 27:194/349 of 2d1fA
Sites not aligning to the query:
>H281DRAFT_00811 FitnessBrowser__Burk376:H281DRAFT_00811
MNYLSTRGAGAGERHTFSDILLGGLAKDGGLYLPAEYPRVSADELARWRTLPYADLAFEI
LSKFSDDIPAEDLRALTRKTYTAQTYCNVRDDEGAEQITPLKTLGIENGAPLSLLELSNG
PTLAFKDMAMQLIGNLFEYALAKHGETLNILGATSGDTGSAAEYAMRGKQGIRVFMLSPH
KKMSAFQTAQMYSLQDPNIFNLAVEGVFDDCQDIVKAVSNDHAFKAKYKIGTVNSINWAR
VVAQVVYYFKGYFAATKSNDERVSFTVPSGNFGNVCAGHIARMMGLPIEKLVVATNENDV
LDEFFRTGIYRVRKAAETYHTSSPSMDISKASNFERFVFDLLGRDPARVLQLFRDVEEKG
GFDLAASGDFARVKEFGFVSGRSSHDDRVEAIRDVFQRYDTMIDTHTADGLKVAREHLQP
GVPMIVLETAQPIKFGETIREALLREPERPAAFTGLESLPQRFEVLPADAQRVKDFIVAN
TGA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory