SitesBLAST
Comparing H281DRAFT_00856 FitnessBrowser__Burk376:H281DRAFT_00856 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2dcnA Crystal structure of 2-keto-3-deoxygluconate kinase from sulfolobus tokodaii complexed with 2-keto-6-phosphogluconate (alpha-furanose form)
31% identity, 96% coverage: 10:309/311 of query aligns to 2:305/308 of 2dcnA
- active site: G252 (= G256), A253 (= A257), G254 (= G258), D255 (= D259)
- binding adenosine-5'-diphosphate: D193 (≠ S196), K223 (= K227), G225 (= G229), P226 (≠ K230), G228 (= G232), V247 (≠ A251), G254 (= G258), I279 (≠ N283), S282 (≠ A286), V286 (≠ T290)
- binding 6-O-phosphono-beta-D-psicofuranosonic acid: G33 (= G37), F89 (≠ Y93), Y105 (= Y106), R107 (= R108), I136 (= I137), R165 (= R170), T251 (= T255), G252 (= G256), D255 (= D259), D291 (≠ A295)
Q97U29 2-dehydro-3-deoxygluconokinase/2-dehydro-3-deoxygalactonokinase; 2-dehydro-3-deoxyglucono/galactono-kinase; 2-keto-3-deoxy-galactonokinase; 2-keto-3-deoxygluconokinase; 3-deoxy-2-oxo-D-gluconate kinase; KDG kinase; KDGal kinase; EC 2.7.1.178 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
30% identity, 96% coverage: 10:309/311 of query aligns to 3:308/313 of Q97U29
2varA Crystal structure of sulfolobus solfataricus 2-keto-3-deoxygluconate kinase complexed with 2-keto-3-deoxygluconate (see paper)
30% identity, 96% coverage: 10:309/311 of query aligns to 2:307/311 of 2varA
- active site: G254 (= G256), A255 (= A257), G256 (= G258), D257 (= D259)
- binding adenosine monophosphate: G227 (= G229), G230 (= G232), M259 (≠ F261), S284 (≠ A286), I288 (≠ T290)
- binding phosphoaminophosphonic acid-adenylate ester: K225 (= K227), G227 (= G229), S228 (≠ K230), G230 (= G232), G254 (= G256), A255 (= A257), G256 (= G258), D257 (= D259), M259 (≠ F261), I281 (≠ N283), S284 (≠ A286), I288 (≠ T290)
- binding 3-deoxy-alpha-D-erythro-hex-2-ulofuranosonic acid: L10 (≠ M18), G33 (= G37), S34 (≠ D38), Y89 (= Y93), Y105 (= Y106), R107 (= R108), I136 (= I137), R165 (= R170), G254 (= G256), D257 (= D259)
- binding 2-keto-3-deoxygluconate: G33 (= G37), S34 (≠ D38), Y89 (= Y93), L103 (≠ F104), Y105 (= Y106), R107 (= R108), I136 (= I137), R165 (= R170), T253 (= T255), G254 (= G256), D257 (= D259), D293 (≠ A295)
5eynA Crystal structure of fructokinase from vibrio cholerae o395 in fructose, adp, beryllium trifluoride and calcium ion bound form
30% identity, 91% coverage: 28:309/311 of query aligns to 19:305/306 of 5eynA
- active site: G246 (= G256), A247 (= A257), G248 (= G258), D249 (= D259)
- binding adenosine-5'-diphosphate: H91 (≠ D100), T217 (≠ K227), G219 (= G229), A220 (≠ K230), A238 (≠ V248), V239 (= V249), T244 (≠ A254), G246 (= G256), A247 (= A257), G248 (= G258), F251 (= F261), N279 (= N283), G282 (≠ A286), A283 (= A287)
- binding beryllium trifluoride ion: G246 (= G256), G248 (= G258), D249 (= D259)
- binding beta-D-fructofuranose: G28 (= G37), A29 (≠ D38), N32 (= N41), F96 (= F104), F98 (≠ Y106), R159 (= R170), D249 (= D259)
Sites not aligning to the query:
5yggA Crystal structure of fructokinase double-mutant (t261c-h108c) from vibrio cholerae o395 in fructose, adp and potassium ion bound form (see paper)
30% identity, 91% coverage: 28:309/311 of query aligns to 23:309/310 of 5yggA
- binding adenosine-5'-diphosphate: K188 (≠ L194), T221 (≠ K227), G223 (= G229), A242 (≠ V248), V243 (= V249), F255 (= F261), N283 (= N283), G286 (≠ A286), A287 (= A287)
- binding beta-D-fructofuranose: G32 (= G37), A33 (≠ D38), F100 (= F104), F102 (≠ Y106), R163 (= R170), D253 (= D259)
Sites not aligning to the query:
3iq0B Crystal structure of a putative ribokinase ii in complex with atp and mg+2 from e.Coli
30% identity, 92% coverage: 10:296/311 of query aligns to 3:292/308 of 3iq0B
- active site: G252 (= G256), A253 (= A257), G254 (= G258), D255 (= D259)
- binding adenosine-5'-triphosphate: S192 (= S196), K223 (= K227), G225 (= G229), E247 (≠ A251), A253 (= A257), G254 (= G258), F257 (= F261), N279 (= N283), G282 (≠ A286)
Q53W83 2-dehydro-3-deoxygluconokinase; 2-keto-3-deoxygluconokinase; 3-deoxy-2-oxo-D-gluconate kinase; KDG kinase; EC 2.7.1.45 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
35% identity, 96% coverage: 10:309/311 of query aligns to 3:301/309 of Q53W83
1v1aA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound 2- keto-3-deoxygluconate and adp (see paper)
35% identity, 96% coverage: 10:309/311 of query aligns to 3:301/301 of 1v1aA
- active site: G248 (= G256), A249 (= A257), G250 (= G258), D251 (= D259)
- binding adenosine-5'-diphosphate: K219 (= K227), G221 (= G229), A222 (≠ K230), A249 (= A257), G250 (= G258), N275 (= N283), A279 (= A287)
- binding 2-keto-3-deoxygluconate: L11 (≠ M18), G34 (= G37), A35 (≠ D38), N38 (= N41), Y89 (= Y93), R105 (= R108), R167 (= R170), G248 (= G256), D251 (= D259), D287 (≠ A295)
1v1bA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound atp (see paper)
36% identity, 89% coverage: 10:287/311 of query aligns to 3:279/300 of 1v1bA
- active site: G248 (= G256), A249 (= A257), G250 (= G258), D251 (= D259)
- binding adenosine-5'-triphosphate: K219 (= K227), G221 (= G229), A238 (≠ G246), F239 (≠ H247), V241 (= V249), G248 (= G256), A249 (= A257), G250 (= G258), N275 (= N283), A279 (= A287)
3in1A Crystal structure of a putative ribokinase in complex with adp from e.Coli
31% identity, 88% coverage: 36:309/311 of query aligns to 39:308/312 of 3in1A
- active site: R106 (vs. gap), G255 (= G256), A256 (= A257), G257 (= G258), D258 (= D259)
- binding adenosine-5'-diphosphate: N194 (≠ S196), K225 (= K227), G227 (= G229), G230 (= G232), A244 (≠ G246), T253 (≠ A254), N282 (= N283), A285 (= A286)
Q8ZKR2 Aminoimidazole riboside kinase; AIRs kinase; EC 2.7.1.223 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
28% identity, 95% coverage: 6:300/311 of query aligns to 2:298/319 of Q8ZKR2
- D16 (≠ E20) binding
- G31 (= G37) binding
- Y101 (= Y106) binding
- R162 (= R170) binding
- A180 (≠ V182) binding
- A181 (≠ M183) binding
- A183 (≠ E185) binding
- G213 (= G220) binding
- D246 (= D253) binding
- T248 (= T255) binding
- D252 (= D259) binding
- A287 (≠ S289) binding
- A290 (≠ G292) binding
- G292 (= G294) binding
4xckA Vibrio cholerae o395 ribokinase complexed with adp, ribose and cesium ion. (see paper)
32% identity, 90% coverage: 30:310/311 of query aligns to 32:303/306 of 4xckA
- active site: A249 (≠ G256), A250 (= A257), G251 (= G258), D252 (= D259)
- binding adenosine-5'-diphosphate: T220 (≠ K227), G222 (= G229), S223 (≠ K230), V242 (= V249), T247 (≠ A254), A250 (= A257), F254 (= F261), H276 (≠ N283), A279 (= A286), V283 (≠ T290)
- binding alpha-D-ribofuranose: G39 (= G37), K40 (≠ D38), N43 (= N41), A95 (≠ Y93), I107 (≠ D105), I109 (≠ L107), E140 (≠ A140), T248 (= T255), D252 (= D259)
Sites not aligning to the query:
1tz6A Crystal structure of aminoimidazole riboside kinase from salmonella enterica complexed with aminoimidazole riboside and atp analog (see paper)
28% identity, 94% coverage: 10:300/311 of query aligns to 2:287/297 of 1tz6A
- active site: C24 (≠ G34), F88 (= F104), G238 (= G256), A239 (= A257), G240 (= G258), D241 (= D259)
- binding phosphomethylphosphonic acid adenylate ester: N149 (= N168), K176 (≠ L194), E181 (≠ D199), S209 (≠ K227), G211 (= G229), A212 (≠ K230), G214 (= G232), A239 (= A257), G240 (= G258), F243 (= F261), N270 (= N283), G273 (≠ A286), A274 (= A287)
- binding 5-aminoimidazole ribonucleoside: D8 (≠ E16), D12 (≠ E20), G27 (= G37), F88 (= F104), Y90 (= Y106), R151 (= R170), M154 (≠ L173), D241 (= D259)
1tz3A Crystal structure of aminoimidazole riboside kinase complexed with aminoimidazole riboside (see paper)
28% identity, 94% coverage: 10:300/311 of query aligns to 2:287/299 of 1tz3A
- active site: C24 (≠ G34), F88 (= F104), G238 (= G256), A239 (= A257), G240 (= G258), D241 (= D259)
- binding 5-aminoimidazole ribonucleoside: D8 (≠ E16), S10 (≠ M18), D12 (≠ E20), G27 (= G37), L83 (≠ Y93), F88 (= F104), Y90 (= Y106), R151 (= R170), M154 (≠ L173), D241 (= D259)
3ih0A Crystal structure of an uncharacterized sugar kinase ph1459 from pyrococcus horikoshii in complex with amp-pnp
29% identity, 92% coverage: 11:295/311 of query aligns to 3:284/304 of 3ih0A
3gbuA Crystal structure of an uncharacterized sugar kinase ph1459 from pyrococcus horikoshii in complex with atp
29% identity, 92% coverage: 11:295/311 of query aligns to 2:283/302 of 3gbuA
- active site: G242 (= G256), A243 (= A257), G244 (= G258), D245 (= D259)
- binding adenosine-5'-triphosphate: K188 (≠ L194), T213 (≠ K227), G215 (= G229), V235 (= V249), P237 (≠ A251), A243 (= A257), G244 (= G258), A274 (= A286)
4ebuA Crystal structure of a sugar kinase (target efi-502312) from oceanicola granulosus, with bound amp/adp crystal form i
34% identity, 86% coverage: 10:277/311 of query aligns to 16:283/306 of 4ebuA
Sites not aligning to the query:
4eumA Crystal structure of a sugar kinase (target efi-502132) from oceanicola granulosus with bound amp, crystal form ii
34% identity, 86% coverage: 10:277/311 of query aligns to 16:279/294 of 4eumA
Sites not aligning to the query:
6a8cA Ribokinase from leishmania donovani with adp (see paper)
27% identity, 94% coverage: 9:300/311 of query aligns to 14:317/327 of 6a8cA
- binding adenosine-5'-diphosphate: G245 (= G229), A246 (≠ K230), T271 (≠ A254), A274 (= A257), G275 (= G258), N300 (= N283), A303 (= A286)
- binding glycerol: D25 (≠ E20), S42 (vs. gap), S44 (≠ N30), G50 (= G36), G51 (= G37), N55 (= N41)
6a8bA Ribokinase from leishmania donovani with amppcp (see paper)
27% identity, 94% coverage: 9:300/311 of query aligns to 14:317/327 of 6a8bA
- binding phosphomethylphosphonic acid adenylate ester: G245 (= G229), A246 (≠ K230), T271 (≠ A254), A274 (= A257), G275 (= G258), N300 (= N283), A303 (= A286), V307 (≠ T290)
- binding glycerol: D25 (≠ E20), G50 (= G36), G51 (= G37), N55 (= N41), N157 (≠ S144), I159 (≠ C146), E190 (≠ P175)
Query Sequence
>H281DRAFT_00856 FitnessBrowser__Burk376:H281DRAFT_00856
MSVNTSAKPEILALGEAMIEFNQSAKDEPNYLQGFGGDTSNFCIAAARQGARTGFVSAVG
ADHFGRLLIDLWEREQVDTALVRVDPHASTGVYFVSHGPDGHAFDYLRAGSAASRYAPRD
LPLDAIAAAKVIHLSGISLAISLSACDAALEAITHARANGVQVSFDTNLRLKLWPLNRAR
AVMLEAIRQTDICLPSWDDVTELTGLTGRDEIVDFLLSHGPRVVALKLGKEGSYIATPDE
RRVVPGHVVNAVDATGAGDCFGGAFIARLVEGDDPFEAARYANVAAALSTQGYGAVAPIP
SRAAVERILAG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory