SitesBLAST
Comparing H281DRAFT_00860 FitnessBrowser__Burk376:H281DRAFT_00860 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O53289 Phosphoserine phosphatase SerB2; PSP; PSPase; O-phosphoserine phosphohydrolase; Protein-serine/threonine phosphatase; EC 3.1.3.3; EC 3.1.3.16 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
44% identity, 80% coverage: 56:279/279 of query aligns to 163:384/409 of O53289
- D185 (= D78) mutation to G: Completely abolishes enzymatic activity.; mutation to N: Completely abolishes enzymatic activity.
- V186 (≠ M79) mutation to Q: Decreases enzymatic activity by 50%.
- D187 (= D80) mutation to N: Decreases enzymatic activity by 15%.
- S188 (= S81) mutation to A: No effect on enzymatic activity.
- S273 (= S168) mutation to A: Completely abolishes enzymatic activity (PubMed:25521849). Decreases enzymatic activity by 60% (PubMed:25037224).
- K318 (= K213) mutation to A: Decreases enzymatic activity by 50%.; mutation to E: Completely abolishes enzymatic activity.
- D341 (= D236) mutation to G: Decreases enzymatic activity by 80%.; mutation to N: Decreases enzymatic activity by 85%. Completely abolishes enzymatic activity, does not elicit cytoskeletal rearrangements, and does not suppress IL-8 production after TNF-alpha stimulation; when associated with N-345.
- D345 (= D240) mutation to N: Decreases enzymatic activity by 55%. Completely abolishes enzymatic activity, does not elicit cytoskeletal rearrangements, and does not suppress IL-8 production after TNF-alpha stimulation; when associated with N-341.
Sites not aligning to the query:
- 18 G→A: Does not bind L-serine and correspondingly no oligomeric transitions is observed in the presence of L-serine.
- 108 G→A: Does not bind L-serine and correspondingly no oligomeric transitions is observed in the presence of L-serine.
8a21A Crystal structure of phosphoserine phosphatase serb from mycobacterium avium in complex with phenylimidazole (see paper)
41% identity, 86% coverage: 41:279/279 of query aligns to 146:382/396 of 8a21A
- binding magnesium ion: D183 (= D78), D185 (= D80), D339 (= D236)
- binding 4-phenyl-1h-imidazole: D185 (= D80), E192 (= E87), V193 (≠ C88), I194 (= I89), T211 (= T106), M215 (= M110), F221 (= F117), R228 (= R124), G273 (= G170)
Sites not aligning to the query:
8a1zA Crystal structure of phosphoserine phosphatase serb from mycobacterium avium in complex with 1-(2,4-dichlorophenyl)-3-hydroxyurea (see paper)
41% identity, 86% coverage: 41:279/279 of query aligns to 146:382/396 of 8a1zA
- binding 1-(2,4-dichlorophenyl)-3-oxidanyl-urea: D185 (= D80), E192 (= E87), M215 (= M110), F221 (= F117), L225 (= L121), R228 (= R124), G272 (= G169), F274 (= F171), D339 (= D236)
- binding magnesium ion: D183 (= D78), D185 (= D80), D339 (= D236)
A0QJI1 Phosphoserine phosphatase; PSP; PSPase; O-phosphoserine phosphohydrolase; EC 3.1.3.3 from Mycobacterium avium (strain 104) (see paper)
41% identity, 86% coverage: 41:279/279 of query aligns to 150:386/411 of A0QJI1
- D187 (= D78) binding
- D189 (= D80) binding
- D343 (= D236) binding
5jlpA Crystal structure of mycobacterium avium serb2 in complex with serine at act domain
41% identity, 86% coverage: 41:279/279 of query aligns to 146:382/396 of 5jlpA
Sites not aligning to the query:
7qplA Crystal structure of phosphoserine phosphatase (serb) from brucella melitensis in complex with phosphate and magnesium
42% identity, 86% coverage: 39:278/279 of query aligns to 53:285/295 of 7qplA
1f5sA Crystal structure of phosphoserine phosphatase from methanococcus jannaschii (see paper)
40% identity, 73% coverage: 74:277/279 of query aligns to 6:207/210 of 1f5sA
- active site: D10 (= D78), F11 (≠ M79), D12 (= D80), G99 (= G169), K143 (= K213), D170 (= D240)
- binding magnesium ion: D10 (= D78), D12 (= D80), D166 (= D236)
- binding phosphate ion: D10 (= D78), F11 (≠ M79), D12 (= D80), S98 (= S168), G99 (= G169), K143 (= K213)
Q58989 Phosphoserine phosphatase; PSP; PSPase; O-phosphoserine phosphohydrolase; EC 3.1.3.3 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see 3 papers)
40% identity, 73% coverage: 74:277/279 of query aligns to 7:208/211 of Q58989
- D11 (= D78) active site, Nucleophile; binding ; mutation to N: Loss of activity.
- D13 (= D80) active site, Proton donor; binding
- E20 (= E87) binding
- R56 (= R124) binding
- SG 99:100 (= SG 168:169) binding
- K144 (= K213) binding
- D167 (= D236) binding
- N170 (= N239) binding
1l7nA Transition state analogue of phosphoserine phosphatase (aluminum fluoride complex) (see paper)
40% identity, 73% coverage: 74:277/279 of query aligns to 5:206/209 of 1l7nA
- active site: D9 (= D78), F10 (≠ M79), D11 (= D80), G98 (= G169), K142 (= K213), D169 (= D240)
- binding aluminum fluoride: D9 (= D78), F10 (≠ M79), D11 (= D80), S97 (= S168), K142 (= K213)
- binding tetrafluoroaluminate ion: D9 (= D78), F10 (≠ M79), D11 (= D80), S97 (= S168), G98 (= G169), K142 (= K213), N168 (= N239)
- binding magnesium ion: D9 (= D78), D11 (= D80), D165 (= D236)
1l7pA Substrate bound phosphoserine phosphatase complex structure (see paper)
39% identity, 73% coverage: 74:277/279 of query aligns to 4:205/208 of 1l7pA
- active site: N8 (≠ D78), F9 (≠ M79), D10 (= D80), G97 (= G169), K141 (= K213), D168 (= D240)
- binding phosphoserine: N8 (≠ D78), F9 (≠ M79), D10 (= D80), E17 (= E87), M40 (= M110), F46 (= F117), R53 (= R124), S96 (= S168), G97 (= G169), K141 (= K213)
1l7oA Crystal structure of phosphoserine phosphatase in apo form (see paper)
38% identity, 73% coverage: 74:277/279 of query aligns to 4:197/200 of 1l7oA
3m1yC Crystal structure of a phosphoserine phosphatase (serb) from helicobacter pylori
34% identity, 70% coverage: 74:268/279 of query aligns to 5:196/208 of 3m1yC
1l8oA Molecular basis for the local conformational rearrangement of human phosphoserine phosphatase (see paper)
26% identity, 70% coverage: 75:270/279 of query aligns to 14:210/222 of 1l8oA
- active site: D17 (= D78), V18 (≠ M79), D19 (= D80), G107 (= G169), K155 (= K213), D180 (= D240)
- binding phosphate ion: D17 (= D78), D19 (= D80), S106 (= S168), K155 (= K213)
- binding serine: G177 (= G237), T179 (≠ N239), R199 (≠ V259)
1l8lA Molecular basis for the local confomational rearrangement of human phosphoserine phosphatase (see paper)
26% identity, 70% coverage: 75:270/279 of query aligns to 14:210/222 of 1l8lA
- active site: D17 (= D78), V18 (≠ M79), D19 (= D80), G107 (= G169), K155 (= K213), D180 (= D240)
- binding d-2-amino-3-phosphono-propionic acid: D17 (= D78), D19 (= D80), G107 (= G169), K155 (= K213), D176 (= D236), G177 (= G237), T179 (≠ N239)
6q6jB Human phosphoserine phosphatase with substrate analogue homo-cysteic acid (see paper)
26% identity, 70% coverage: 75:270/279 of query aligns to 13:209/217 of 6q6jB
- binding calcium ion: D16 (= D78), D18 (= D80), D175 (= D236)
- binding (2~{S})-2-azanyl-4-sulfo-butanoic acid: D16 (= D78), V17 (≠ M79), D18 (= D80), F54 (= F117), S105 (= S168), G106 (= G169), G107 (= G170), K154 (= K213), T178 (≠ N239)
6hyjB Psph human phosphoserine phosphatase (see paper)
26% identity, 70% coverage: 75:270/279 of query aligns to 17:213/223 of 6hyjB
P78330 Phosphoserine phosphatase; PSP; PSPase; L-3-phosphoserine phosphatase; O-phosphoserine phosphohydrolase; EC 3.1.3.3 from Homo sapiens (Human) (see 4 papers)
26% identity, 70% coverage: 75:270/279 of query aligns to 17:213/225 of P78330
- D20 (= D78) binding
- DVD 20:22 (≠ DMD 78:80) binding
- D22 (= D80) binding
- S23 (= S81) mutation to A: Reduces L-phosphoserine phosphatase activity by about 50%.; mutation to T: Reduces L-phosphoserine phosphatase activity by about 80%.
- E29 (= E87) mutation to D: Reduces L-phosphoserine phosphatase activity by about 95%.; mutation to Q: Loss of L-phosphoserine phosphatase activity.
- D32 (= D90) to N: in PSPHD; decreased L-phosphoserine phosphatase activity; dbSNP:rs104894035
- A35 (= A93) to T: in PSPHD; decreased L-phosphoserine phosphatase activity
- M52 (= M110) binding ; to T: in PSPHD; decreased L-phosphoserine phosphatase activity; dbSNP:rs104894036
- G53 (≠ R111) binding
- R65 (= R124) mutation R->A,K: Loss of L-phosphoserine phosphatase activity.
- SGG 109:111 (= SGG 168:170) binding ; binding
- N133 (= N190) mutation to A: Reduces L-phosphoserine phosphatase activity by about 75%.
- K158 (= K213) binding ; binding
- D179 (= D236) binding
- T182 (≠ N239) binding ; binding ; mutation to S: Reduces L-phosphoserine phosphatase activity by about 99%.; mutation to V: Reduces L-phosphoserine phosphatase activity by about 25%.
- R202 (≠ V259) mutation to A: Reduces L-phosphoserine phosphatase activity by about 99%.; mutation to K: Reduces L-phosphoserine phosphatase activity by about 95%.
6hyyA Human phosphoserine phosphatase with serine and phosphate (see paper)
26% identity, 70% coverage: 75:270/279 of query aligns to 13:209/221 of 6hyyA
4ap9A Crystal structure of phosphoserine phosphatase from t.Onnurineus in complex with ndsb-201 (see paper)
31% identity, 63% coverage: 77:252/279 of query aligns to 14:174/200 of 4ap9A
- active site: D15 (= D78), I16 (≠ M79), E17 (≠ D80), G103 (= G169), K141 (≠ L217), D162 (= D240)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: R31 (≠ D94), I32 (≠ F95), T33 (≠ C96), L46 (≠ M110), W52 (≠ F117), D140 (≠ T216), K141 (≠ L217), Y160 (≠ S238), A161 (≠ N239)
6iuyA Structure of dsgpdh of dunaliella salina (see paper)
33% identity, 35% coverage: 75:171/279 of query aligns to 17:114/585 of 6iuyA
Sites not aligning to the query:
- binding magnesium ion: 175
- binding nicotinamide-adenine-dinucleotide: 233, 234, 235, 236, 268, 290, 321, 324, 349, 381, 382, 497, 529, 530, 532
Query Sequence
>H281DRAFT_00860 FitnessBrowser__Burk376:H281DRAFT_00860
MNLVIQSPAPISTDHHKTLVALSRGSHATVVDANAIRISDADIAQRPDLDVYCGTHRLDY
AFVEAGRQLRDFGLVAMDMDSTLITIECIDEIADFCGLKAEVAAITEASMRGEIKDFNES
LTRRVALLKGLDASALERVYEERLQLSPGAEQMLAGAKEAGLKTLLVSGGFNFFTEKLKA
RLGLDFTRANTLDIVDGKLTGKVIGEIVNADVKARTLRETCAQLGIEPSRAIAMGDGSND
LKMMAEAGLSVAFRAKPVVREAASVAFNYVGLDGLLRLF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory