Comparing H281DRAFT_00879 FitnessBrowser__Burk376:H281DRAFT_00879 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7rsfA Acetylornithine deacetylase from escherichia coli
32% identity, 78% coverage: 84:409/416 of query aligns to 63:377/380 of 7rsfA
7uoiA Crystallographic structure of dape from enterococcus faecium
28% identity, 76% coverage: 87:401/416 of query aligns to 64:374/383 of 7uoiA
Q8P8J5 N-acetyl-L-citrulline deacetylase; ACDase; Acetylcitrulline deacetylase; EC 3.5.1.- from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) (see paper)
26% identity, 91% coverage: 29:407/416 of query aligns to 8:363/366 of Q8P8J5
5vo3A Crystal structure of dape in complex with the products (succinic acid and diaminopimelic acid) (see paper)
27% identity, 89% coverage: 36:406/416 of query aligns to 16:375/380 of 5vo3A
P44514 Succinyl-diaminopimelate desuccinylase; SDAP desuccinylase; N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase; EC 3.5.1.18 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 3 papers)
27% identity, 89% coverage: 36:406/416 of query aligns to 12:371/377 of P44514
2f7vA Structure of acetylcitrulline deacetylase complexed with one co (see paper)
27% identity, 91% coverage: 29:407/416 of query aligns to 9:358/360 of 2f7vA
7lgpB Dape enzyme from shigella flexneri
27% identity, 78% coverage: 87:409/416 of query aligns to 60:375/377 of 7lgpB
7t1qA Crystal structure of the succinyl-diaminopimelate desuccinylase (dape) from acinetobacter baumannii in complex with succinic acid
32% identity, 50% coverage: 95:302/416 of query aligns to 64:274/377 of 7t1qA
Sites not aligning to the query:
4o23A Crystal structure of mono-zinc form of succinyl diaminopimelate desuccinylase from neisseria meningitidis mc58 (see paper)
31% identity, 47% coverage: 93:286/416 of query aligns to 62:258/376 of 4o23A
4pqaA Crystal structure of succinyl-diaminopimelate desuccinylase from neisseria meningitidis mc58 in complex with the inhibitor captopril (see paper)
31% identity, 47% coverage: 93:286/416 of query aligns to 62:258/375 of 4pqaA
Sites not aligning to the query:
3pfoA Crystal structure of a putative acetylornithine deacetylase (rpa2325) from rhodopseudomonas palustris cga009 at 1.90 a resolution
25% identity, 75% coverage: 93:406/416 of query aligns to 99:417/426 of 3pfoA
4h2kA Crystal structure of the catalytic domain of succinyl-diaminopimelate desuccinylase from haemophilus influenzae (see paper)
33% identity, 37% coverage: 43:197/416 of query aligns to 19:172/258 of 4h2kA
Sites not aligning to the query:
4op4B Crystal structure of the catalytic domain of dape protein from v.Cholerea in the zn bound form (see paper)
35% identity, 33% coverage: 56:193/416 of query aligns to 31:166/265 of 4op4B
Sites not aligning to the query:
P37111 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Sus scrofa (Pig) (see paper)
26% identity, 49% coverage: 89:292/416 of query aligns to 71:281/407 of P37111
Sites not aligning to the query:
Q03154 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Homo sapiens (Human) (see 6 papers)
25% identity, 49% coverage: 89:292/416 of query aligns to 71:282/408 of Q03154
Sites not aligning to the query:
Q8C165 N-fatty-acyl-amino acid synthase/hydrolase PM20D1; Peptidase M20 domain-containing protein 1; PM20D1; EC 3.5.1.114; EC 3.5.1.14 from Mus musculus (Mouse) (see paper)
32% identity, 41% coverage: 52:222/416 of query aligns to 81:264/503 of Q8C165
Sites not aligning to the query:
P06621 Carboxypeptidase G2; CPDG2; Folate hydrolase G2; Glutamate carboxypeptidase; Pteroylmonoglutamic acid hydrolase G2; Glucarpidase; EC 3.4.17.11 from Pseudomonas sp. (strain RS-16) (see paper)
27% identity, 61% coverage: 57:311/416 of query aligns to 73:313/415 of P06621
Sites not aligning to the query:
1cg2A Carboxypeptidase g2 (see paper)
27% identity, 61% coverage: 57:311/416 of query aligns to 48:288/389 of 1cg2A
Sites not aligning to the query:
7m6uB Crystal structure of a circular permutation and computationally designed pro-enzyme of carboxypeptidase g2 (see paper)
26% identity, 56% coverage: 77:311/416 of query aligns to 4:223/392 of 7m6uB
Sites not aligning to the query:
3ki9A Crystal structure of staphylococcus aureus metallopeptidase (sapep/dape) in the mn2+ bound form (see paper)
34% identity, 31% coverage: 64:190/416 of query aligns to 57:183/467 of 3ki9A
Sites not aligning to the query:
>H281DRAFT_00879 FitnessBrowser__Burk376:H281DRAFT_00879
MSHVADSAQSSQTSATASSDSASGTTPVSLPWVTRLVSMDTVSRNPNLGLIETVRDELRA
LGIEGTLTHDASGKWANLFATIPAHDGETNGGVVLSGHTDVVPVDGQQWDSDPFKPEIRG
DKLYGRGTCDMKGFIGAALALVPDMQRTKLAKPIHFALSFDEEVGCAGAPLLIADLMKRG
VKPDGCIVGEPTSMRPIVAHKGINAYQCCVRGQAAHSSLTPKGLNAIEYAARLICYIRDM
ADQFREQGPFDELYDVPFTTAQTSTIVGGNAINTVPAECKFQFEFRNLPTLDPEPIFARI
DQYARETLLPKMLREHPLAAIEITKIAAAPGLDSSEQAAITQLVRALTADQDKRKVAYGT
EAGLFSLAGIPSIVCGPGDIQQAHKANEFVALDQLVQCERFLHKFIHSMSVEAHAR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory