SitesBLAST
Comparing H281DRAFT_00908 FitnessBrowser__Burk376:H281DRAFT_00908 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 9 hits to proteins with known functional sites (download)
2gagB Heteroteterameric sarcosine: structure of a diflavin metaloenzyme at 1.85 a resolution (see paper)
26% identity, 52% coverage: 210:432/432 of query aligns to 186:388/403 of 2gagB
- binding flavin-adenine dinucleotide: V195 (= V219), G224 (= G258), A225 (≠ G259), H227 (≠ G261), L231 (= L265), L246 (≠ V280), G352 (= G393), T353 (≠ P394), G354 (≠ A395), G355 (= G396), F356 (≠ W397), K357 (≠ G398)
- binding flavin mononucleotide: V250 (= V284), E278 (≠ R315), R321 (≠ L362), W323 (= W364)
- binding 2-furoic acid: M263 (≠ I298), Y270 (≠ G306), K357 (≠ G398)
- binding sulfite ion: K276 (≠ R313)
Sites not aligning to the query:
- active site: 61, 64, 65
- binding flavin-adenine dinucleotide: 26, 28, 29, 30, 51, 52, 58, 59, 60, 62, 63, 64, 66
- binding flavin mononucleotide: 61, 62, 171
- binding 2-furoic acid: 64, 66, 68, 401
- binding sulfite ion: 170
P40875 Sarcosine oxidase subunit beta; Sarcosine oxidase subunit B; Sarcosine oxidase (5,10-methylenetetrahydrofolate-forming) subunit beta; Tetrameric sarcosine oxidase subunit beta; TSOX subunit beta; EC 1.5.3.24 from Corynebacterium sp. (strain P-1) (see 3 papers)
25% identity, 47% coverage: 210:414/432 of query aligns to 188:375/405 of P40875
- C195 (= C217) mutation to S: No change in activity.
- C351 (≠ V390) mutation to A: No change in activity.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 30 G→A: Prevents covalent attachment of FMN. Blocks subunit assembly.
- 146 C→S: No change in activity.
- 173 modified: Tele-8alpha-FMN histidine; H→N: Prevents covalent attachment of FMN. Loss of activity. The mutant is considerably less stable than wild-type enzyme, the beta and delta subunits are lost during purification, which yields a stable alpha-gamma complex.
- 175 H→A: No effect on FMN binding and activity.
S5FMM4 Glycine oxidase; GO; BliGO; EC 1.4.3.19 from Bacillus licheniformis (see paper)
26% identity, 46% coverage: 234:430/432 of query aligns to 183:363/369 of S5FMM4
- S202 (≠ G258) mutation to C: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, V-332 and V-342.
- I332 (≠ W397) mutation to V: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, C-202 and V-342.
- M342 (≠ I407) mutation to V: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, C-202 and V-332.
Sites not aligning to the query:
- 51 G→S: Shows 4.3- and 107-fold increase of affinity to glyphosate and glycine, respectively. Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with R-54, R-81, C-202, V-332 and V-342.
- 54 A→R: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-81, C-202, V-332 and V-342.
- 81 K→R: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, C-202, V-332 and V-342.
4x9mA Oxidized l-alpha-glycerophosphate oxidase from mycoplasma pneumoniae with fad bound (see paper)
39% identity, 11% coverage: 2:47/432 of query aligns to 5:50/384 of 4x9mA
- binding flavin-adenine dinucleotide: G10 (= G7), G12 (= G9), I14 (≠ A11), E33 (= E30), K34 (≠ R31), E41 (≠ G38), T42 (≠ A39), S43 (≠ T40), A45 (≠ G42), N46 (≠ H43), S47 (≠ G44), V49 (≠ T46)
- binding sn-glycerol-3-phosphate: S47 (≠ G44)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 51, 176, 177, 209, 210, 212, 234, 319, 320, 346, 347, 348, 349, 350, 351, 352
- binding sn-glycerol-3-phosphate: 51, 258, 259, 320, 348
1vrqB Crystal structure of heterotetrameric sarcosine oxidase from corynebacterium sp. U-96 in complex with folinic acid (see paper)
25% identity, 52% coverage: 210:432/432 of query aligns to 187:389/402 of 1vrqB
- active site: G326 (= G366), K358 (≠ G398)
- binding n,n-dimethylglycine: K358 (≠ G398)
- binding flavin-adenine dinucleotide: V196 (= V219), A224 (= A257), G225 (= G258), H228 (≠ G261), L247 (≠ V280), G353 (= G393), T354 (≠ P394), G355 (≠ A395), G356 (= G396), F357 (≠ W397), K358 (≠ G398)
- binding flavin mononucleotide: V251 (= V284), E279 (≠ R315), R322 (≠ L362), W324 (= W364)
Sites not aligning to the query:
- active site: 62, 65, 66
- binding n,n-dimethylglycine: 65, 67, 69, 401
- binding flavin-adenine dinucleotide: 26, 27, 29, 30, 31, 51, 52, 53, 59, 60, 61, 63, 64, 65, 67
- binding flavin mononucleotide: 62, 63, 172
P75063 Glycerol 3-phosphate oxidase; GlpO; L-alpha-glycerophosphate oxidase; EC 1.1.3.21 from Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1) (Mycoplasmoides pneumoniae) (see paper)
39% identity, 11% coverage: 2:47/432 of query aligns to 5:50/384 of P75063
Sites not aligning to the query:
- 177 binding
- 346:347 binding
- 352 binding
3ad8B Heterotetrameric sarcosine oxidase from corynebacterium sp. U-96 in complex with pyrrole 2-carboxylate (see paper)
25% identity, 52% coverage: 210:432/432 of query aligns to 187:389/404 of 3ad8B
- active site: G326 (= G366), K358 (≠ G398)
- binding flavin-adenine dinucleotide: V196 (= V219), G225 (= G258), A226 (≠ G259), H228 (≠ G261), L247 (≠ V280), G353 (= G393), T354 (≠ P394), G355 (≠ A395), G356 (= G396), F357 (≠ W397), K358 (≠ G398)
- binding flavin mononucleotide: V251 (= V284), E279 (≠ R315), R322 (≠ L362), W324 (= W364)
- binding pyrrole-2-carboxylate: M264 (≠ I298), Y271 (≠ G306), T354 (≠ P394), K358 (≠ G398)
Sites not aligning to the query:
- active site: 62, 65, 66
- binding flavin-adenine dinucleotide: 26, 27, 29, 30, 31, 52, 53, 59, 60, 61, 63, 64, 65, 67
- binding flavin mononucleotide: 62, 63, 172
- binding pyrrole-2-carboxylate: 65, 67, 69, 402
3ad7B Heterotetrameric sarcosine oxidase from corynebacterium sp. U-96 in complex with methylthio acetate (see paper)
25% identity, 52% coverage: 210:432/432 of query aligns to 187:389/404 of 3ad7B
- active site: G326 (= G366), K358 (≠ G398)
- binding flavin-adenine dinucleotide: V196 (= V219), G225 (= G258), A226 (≠ G259), H228 (≠ G261), L247 (≠ V280), G353 (= G393), T354 (≠ P394), G355 (≠ A395), G356 (= G396), F357 (≠ W397), K358 (≠ G398)
- binding flavin mononucleotide: V251 (= V284), K277 (≠ R313), E279 (≠ R315), R322 (≠ L362), W324 (= W364)
- binding [methylthio]acetate: M264 (≠ I298), Y271 (≠ G306), T354 (≠ P394), K358 (≠ G398)
Sites not aligning to the query:
- active site: 62, 65, 66
- binding flavin-adenine dinucleotide: 26, 27, 29, 30, 31, 52, 53, 59, 60, 61, 63, 64, 65, 67
- binding flavin mononucleotide: 62, 63, 172
- binding [methylthio]acetate: 67, 69, 402
Q50LF2 Sarcosine oxidase subunit beta; Sarcosine oxidase subunit B; Sarcosine oxidase (5,10-methylenetetrahydrofolate-forming) subunit beta; Tetrameric sarcosine oxidase subunit beta; TSOX subunit beta; EC 1.5.3.24 from Corynebacterium sp. (strain U-96) (see 4 papers)
25% identity, 52% coverage: 210:432/432 of query aligns to 188:390/405 of Q50LF2
- V197 (= V219) binding
- H270 (≠ R304) mutation to A: 10-fold decrease in catalytic efficiency.
- Y272 (≠ G306) mutation to A: 13000-fold decrease in catalytic efficiency.; mutation to F: 130-fold decrease in catalytic efficiency.
- G354 (= G393) binding
- G357 (= G396) binding
- K359 (≠ G398) binding ; mutation K->A,D: Loss of activity.; mutation to R: Retains 0.07% of wild-type activity. Shows higher apparent KM for sarcosine.
Sites not aligning to the query:
- 31 binding
- 32 binding
- 53 binding
- 61 binding
- 62 binding
- 66 binding
- 68 binding
- 172 K→A: Retains 39% of wild-type activity.; K→D: Retains 32% of wild-type activity.; K→R: Retains 58% of wild-type activity.
- 173 modified: Tele-8alpha-FMN histidine
Query Sequence
>H281DRAFT_00908 FitnessBrowser__Burk376:H281DRAFT_00908
MDVIVIGGGIAGVATAYQLRAAGHRVCVVERHATVAQGATYGHGGTVLPTPLDVWFGPTF
MANRQNAKNGVISKPGFNGPARQFVKKLAELQEPDEFGRQYRLLRPLVELSREAMADMEA
RFGFEFEQASGLLHLVRSAQEWQQLQPALGLLALYEVPHHVLSPAECAAYEHSVRTEPEF
AGGVLFEHERTANCPLFTKLIKQTLDTQGGVQFMLGCEVSAIRLDGQRAAVELAPRPGAA
SGSREVDVIHADTIVVAGGYGSLALLERLGLALPLHPLRVHTLVAPIAHEECAPHVAIVD
AIKRIGISRMNHRLRIAGGAVLQGANLIDKPLGEALTKEALALLGQATHDWIPGAARISA
ALPWEGIKLLSPDGLPVVGNALHPRLFVNVGHGPAGWGLACGAGKLIADLVAGQAPDLPD
ETLAALRADRFR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory