SitesBLAST
Comparing H281DRAFT_00974 FitnessBrowser__Burk376:H281DRAFT_00974 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4e5tA Crystal structure of a putative mandelate racemase/muconate lactonizing enzyme (target psi-200750) from labrenzia alexandrii dfl- 11
65% identity, 97% coverage: 1:394/405 of query aligns to 1:389/392 of 4e5tA
3rcyF Crystal structure of mandelate racemase/muconate lactonizing enzyme- like protein from roseovarius sp. Tm1035
54% identity, 99% coverage: 1:399/405 of query aligns to 1:397/397 of 3rcyF
- active site: K165 (= K164), D167 (= D166), R175 (≠ Y174), G208 (= G207), H210 (= H209), E234 (= E233), G259 (= G258), E260 (= E259), Q281 (= Q280), A283 (≠ N282), H310 (= H309), A313 (≠ N312), L332 (= L331), E335 (= E334)
- binding magnesium ion: E234 (= E233), E260 (= E259)
- binding alpha-D-ribofuranose: R85 (= R85), P86 (= P86), P239 (= P238), A266 (≠ Y265), E267 (= E266)
3rraB Crystal structure of enolase prk14017 (target efi-500653) from ralstonia pickettii 12j with magnesium bound
32% identity, 94% coverage: 1:379/405 of query aligns to 2:356/379 of 3rraB
- active site: I35 (= I40), R38 (≠ A43), Y118 (= Y128), K145 (≠ S175), N147 (≠ H177), E151 (vs. gap), D184 (≠ G207), H186 (= H209), E210 (= E233), G235 (= G258), E236 (= E259), R237 (= R260), Q257 (= Q280), D259 (≠ N282), H286 (= H309), P288 (≠ Y311), E311 (= E334)
- binding magnesium ion: D184 (≠ G207), E210 (= E233), E236 (= E259)
4e6mA Crystal structure of putative dehydratase protein from salmonella enterica subsp. Enterica serovar typhimurium (salmonella typhimurium)
31% identity, 89% coverage: 24:382/405 of query aligns to 27:399/401 of 4e6mA
- active site: L45 (vs. gap), G48 (≠ S42), K169 (= K164), D171 (= D166), I175 (vs. gap), E223 (≠ G207), H225 (= H209), E249 (= E233), G274 (= G258), E275 (= E259), R276 (= R260), Q296 (= Q280), D298 (≠ N282), H325 (= H309), C327 (≠ Y311), E350 (= E334), A355 (≠ V346)
- binding magnesium ion: E223 (≠ G207), E249 (= E233), E275 (= E259)
2qq6B Crystal structure of mandelate racemase/muconate lactonizing enzyme- like protein from rubrobacter xylanophilus dsm 9941
34% identity, 86% coverage: 36:383/405 of query aligns to 31:391/396 of 2qq6B
- active site: P37 (≠ S42), G79 (≠ R85), D124 (≠ K134), K166 (= K164), D168 (= D166), D213 (≠ G207), H215 (= H209), E239 (= E233), G264 (= G258), E265 (= E259), M286 (≠ Q280), D288 (≠ N282), H315 (= H309), N316 (≠ L310), E340 (= E334), D345 (≠ V346)
- binding magnesium ion: D213 (≠ G207), E239 (= E233), E265 (= E259), H315 (= H309)
3sjnA Crystal structure of enolase spea_3858 (target efi-500646) from shewanella pealeana with magnesium bound
30% identity, 88% coverage: 24:378/405 of query aligns to 28:370/373 of 3sjnA
- active site: S46 (= S42), L49 (≠ F45), T139 (≠ Y130), K165 (= K164), G167 (≠ D166), M171 (vs. gap), D198 (vs. gap), A200 (≠ G207), E225 (= E233), I247 (≠ V255), G250 (= G258), E251 (= E259), S252 (≠ R260), Q272 (= Q280), D274 (≠ N282), H301 (= H309), G302 (≠ L310), F303 (≠ Y311), M325 (≠ I332), E326 (≠ Q333), Q329 (≠ I336), S331 (≠ T338)
- binding magnesium ion: D198 (vs. gap), E225 (= E233), E251 (= E259)
4hpnA Crystal structure of a proposed galactarolactone cycloisomerase from agrobacterium tumefaciens, target efi-500704, with bound ca, ordered loops (see paper)
30% identity, 93% coverage: 1:377/405 of query aligns to 1:372/378 of 4hpnA
- active site: F19 (≠ P16), G50 (≠ H46), R53 (≠ A49), T134 (≠ Y130), K164 (= K164), K166 (≠ Q178), D194 (≠ G207), N196 (≠ H209), E220 (= E233), G245 (= G258), E246 (= E259), T247 (≠ R260), Q267 (= Q280), D269 (≠ N282), H296 (= H309), V297 (≠ L310), W298 (≠ Y311), R320 (vs. gap), E329 (= E334), F330 (≠ S335), H334 (≠ W339)
- binding calcium ion: D194 (≠ G207), D209 (≠ K222), E220 (= E233), G237 (≠ H250), E246 (= E259)
2o56A Crystal structure of a member of the enolase superfamily from salmonella typhimurium
29% identity, 89% coverage: 24:382/405 of query aligns to 21:390/392 of 2o56A
- active site: K165 (= K164), D167 (= D166), M171 (vs. gap), L186 (≠ V183), E214 (≠ G207), H216 (= H209), E240 (= E233), G265 (= G258), E266 (= E259), Q287 (= Q280), D289 (≠ N282), H316 (= H309), E341 (= E334), A346 (≠ V346)
- binding magnesium ion: E214 (≠ G207), E240 (= E233), E266 (= E259)
3gy1B Crystal structure of putative mandelate racemase/muconate lactonizing protein from clostridium beijerinckii ncimb 8052
28% identity, 88% coverage: 24:378/405 of query aligns to 23:363/388 of 3gy1B
- active site: R152 (≠ N155), Q154 (≠ K157), D191 (≠ G207), H193 (= H209), E217 (= E233), G242 (= G258), E243 (= E259), R264 (≠ Q280), H266 (≠ N282), H293 (= H309), E320 (= E334)
- binding magnesium ion: D191 (≠ G207), E217 (= E233), E243 (= E259)
3v3wA Crystal structure of an enolase from the soil bacterium cellvibrio japonicus (target efi-502161) with bound mg and glycerol
26% identity, 94% coverage: 1:381/405 of query aligns to 1:379/397 of 3v3wA
- active site: L36 (≠ A43), R39 (≠ H46), H122 (≠ Y130), K144 (≠ P145), R147 (≠ A148), Q149 (≠ E150), Y159 (≠ F160), E179 (≠ M181), D205 (≠ G207), H207 (= H209), E231 (= E233), G256 (= G258), E257 (= E259), V258 (≠ R260), R278 (≠ Q280), T280 (≠ N282), F306 (≠ P308), H307 (= H309), G308 (≠ L310), A309 (≠ Y311), E334 (= E334)
- binding magnesium ion: D205 (≠ G207), E231 (= E233), E257 (= E259)
Sites not aligning to the query:
3rgtA Crystal structure of d-mannonate dehydratase from chromohalobacter salexigens complexed with d-arabinohydroxamate
28% identity, 89% coverage: 20:381/405 of query aligns to 14:365/383 of 3rgtA
- active site: H122 (≠ Y130), R147 (≠ K164), Q149 (≠ D166), D191 (≠ G207), H193 (= H209), E217 (= E233), G242 (= G258), E243 (= E259), R264 (≠ Q280), P266 (≠ N282), H293 (= H309), G294 (vs. gap), E320 (= E334)
- binding cobalt (ii) ion: D191 (≠ G207), E217 (= E233), E243 (= E259)
- binding (2S,3R,4R)-2,3,4,5-tetrahydroxy-N-oxo-pentanamide: N37 (≠ H46), D191 (≠ G207), H193 (= H209), E243 (= E259), H293 (= H309), P295 (vs. gap), D297 (≠ Y311), E320 (= E334)
Sites not aligning to the query:
4e4fB Crystal structure of enolase pc1_0802 (target efi-502240) from pectobacterium carotovorum subsp. Carotovorum pc1
27% identity, 94% coverage: 1:381/405 of query aligns to 2:363/381 of 4e4fB
- active site: L37 (≠ F45), R40 (≠ K48), R148 (≠ K164), Q150 (≠ D166), D189 (≠ G207), H191 (= H209), E215 (= E233), G240 (= G258), E241 (= E259), V242 (≠ R260), R262 (≠ Q280), T264 (≠ N282), H291 (= H309), P293 (≠ Y311), E318 (= E334)
- binding magnesium ion: D189 (≠ G207), E215 (= E233), E241 (= E259)
Sites not aligning to the query:
B3PDB1 D-galactonate dehydratase family member RspA; D-mannonate dehydratase; Starvation sensing protein RspA homolog; EC 4.2.1.-; EC 4.2.1.8 from Cellvibrio japonicus (strain Ueda107) (Pseudomonas fluorescens subsp. cellulosa) (see paper)
26% identity, 94% coverage: 1:381/405 of query aligns to 1:384/402 of B3PDB1
- D210 (≠ G207) binding
- E236 (= E233) binding
- E262 (= E259) binding
3p93C Crystal structure of d-mannonate dehydratase from chromohalobacter salexigens complexed with mg,d-mannonate and 2-keto-3-deoxy-d- gluconate
28% identity, 89% coverage: 20:381/405 of query aligns to 14:366/384 of 3p93C
- active site: H122 (≠ Y130), R147 (≠ K164), Q149 (≠ D166), D192 (≠ G207), H194 (= H209), E218 (= E233), G243 (= G258), E244 (= E259), R265 (≠ Q280), P267 (≠ N282), H294 (= H309), G295 (vs. gap), E321 (= E334)
- binding 2-keto-3-deoxygluconate: N37 (≠ H46), D192 (≠ G207), H194 (= H209), E244 (= E259), H294 (= H309), P296 (vs. gap), D298 (≠ Y311), E321 (= E334)
- binding magnesium ion: D192 (≠ G207), E218 (= E233), E244 (= E259)
Sites not aligning to the query:
3p93A Crystal structure of d-mannonate dehydratase from chromohalobacter salexigens complexed with mg,d-mannonate and 2-keto-3-deoxy-d- gluconate
28% identity, 89% coverage: 20:381/405 of query aligns to 14:366/384 of 3p93A
- active site: H122 (≠ Y130), R147 (≠ K164), Q149 (≠ D166), D192 (≠ G207), H194 (= H209), E218 (= E233), G243 (= G258), E244 (= E259), R265 (≠ Q280), P267 (≠ N282), H294 (= H309), G295 (vs. gap), E321 (= E334)
- binding d-mannonic acid: N37 (≠ H46), D192 (≠ G207), H194 (= H209), E244 (= E259), H294 (= H309), P296 (vs. gap), D298 (≠ Y311), E321 (= E334)
- binding magnesium ion: D192 (≠ G207), E218 (= E233), E244 (= E259)
Sites not aligning to the query:
C6D9S0 D-galactonate dehydratase family member PC1_0802; D-mannonate dehydratase; EC 4.2.1.-; EC 4.2.1.8 from Pectobacterium carotovorum subsp. carotovorum (strain PC1) (see paper)
26% identity, 94% coverage: 1:381/405 of query aligns to 1:386/404 of C6D9S0
- D212 (≠ G207) binding
- E238 (= E233) binding
- E264 (= E259) binding
4kwsA Crystal structure of d-mannonate dehydratase from chromohalobacter salexigens complexed with mg and glycerol
28% identity, 89% coverage: 20:381/405 of query aligns to 14:379/397 of 4kwsA
- active site: H122 (≠ Y130), R147 (≠ K164), Q149 (≠ D166), Y159 (= Y174), D205 (≠ G207), H207 (= H209), E231 (= E233), G256 (= G258), E257 (= E259), R278 (≠ Q280), P280 (≠ N282), H307 (= H309), G308 (vs. gap), E334 (= E334)
- binding magnesium ion: D205 (≠ G207), E231 (= E233), E257 (= E259)
Sites not aligning to the query:
3qkeA Crystal structure of d-mannonate dehydratase from chromohalobacter salexigens complexed with mg and d-gluconate
28% identity, 89% coverage: 20:381/405 of query aligns to 14:379/397 of 3qkeA
- active site: H122 (≠ Y130), R147 (≠ K164), Q149 (≠ D166), Y159 (= Y174), D205 (≠ G207), H207 (= H209), E231 (= E233), G256 (= G258), E257 (= E259), R278 (≠ Q280), P280 (≠ N282), H307 (= H309), G308 (vs. gap), E334 (= E334)
- binding D-gluconic acid: N37 (≠ H46), Y159 (= Y174), D205 (≠ G207), H207 (= H209), E257 (= E259), H307 (= H309), P309 (vs. gap), D311 (≠ Y311), E334 (= E334)
- binding magnesium ion: D205 (≠ G207), E231 (= E233), E257 (= E259)
Sites not aligning to the query:
Q8FHC7 D-galactonate dehydratase family member RspA; D-mannonate dehydratase; Starvation sensing protein RspA homolog; EC 4.2.1.-; EC 4.2.1.8 from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) (see paper)
25% identity, 94% coverage: 1:381/405 of query aligns to 12:397/415 of Q8FHC7
- D223 (≠ G207) binding
- E249 (= E233) binding
- D250 (≠ E234) binding
- E275 (= E259) binding
4il2B Crystal structure of d-mannonate dehydratase (rspa) from e. Coli cft073 (efi target efi-501585)
25% identity, 94% coverage: 1:381/405 of query aligns to 1:386/404 of 4il2B
- active site: L36 (≠ F45), G38 (≠ P47), W76 (≠ T83), R147 (≠ K164), Q149 (≠ D166), Y159 (= Y171), D212 (≠ G207), H214 (= H209), E238 (= E233), G263 (= G258), E264 (= E259), R285 (≠ Q280), T287 (≠ N282), H314 (= H309), E341 (= E334)
- binding magnesium ion: D212 (≠ G207), E238 (= E233), D239 (≠ E234), E264 (= E259)
Sites not aligning to the query:
Query Sequence
>H281DRAFT_00974 FitnessBrowser__Burk376:H281DRAFT_00974
MKVVSLETHVVAVPPPHVGGMYWIFVKLKTDCGIEGVGEIYSATFHPKAMTHIVDDVFSR
YLLDHDPHHVERLWREAYSSGFTQRPDLTMMGVVSGLEMACWDIIGKAAGKPVYELLGGM
VNPRLRSYTYLYPKNNRGEYDYDDPDLAAECAAENVKRGFTAVKFDPAGPYTAYSGHQLS
MEVLDRCETFCRRVREAVGSKADLLFGTHGQMVPSSAIRLAKRLEKYDPLWFEEPVPPGQ
EDAMAQVARHTSIPVAAGERLTTKYEFFKLLQAGAASILQLNVARVGGLLEAKKVAALAE
VYYAQIAPHLYNGPIGAAASIQLAACTPNFLIQESIGTWDGFHAAVLKKPLQWEDGYIIP
SREPGLGVELNMEVVAQHTPYTGERLHLQMAAQPVDVKDLAPAKG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory