SitesBLAST
Comparing H281DRAFT_00981 FitnessBrowser__Burk376:H281DRAFT_00981 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 10 hits to proteins with known functional sites (download)
P53322 High-affinity nicotinic acid transporter; Nicotinic acid permease from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
24% identity, 74% coverage: 3:333/450 of query aligns to 80:402/534 of P53322
- K283 (≠ A216) modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
P0AA76 D-galactonate transporter; D-galactonate/H(+) symporter from Escherichia coli (strain K12) (see paper)
22% identity, 94% coverage: 5:427/450 of query aligns to 8:425/430 of P0AA76
- Y29 (= Y27) binding
- D31 (= D29) mutation to N: Loss of galactonate transport activity.
- R32 (= R30) binding
- Y64 (= Y62) binding
- E118 (= E125) mutation to Q: Loss of galactonate transport activity.
- W358 (= W359) binding
6e9nA E. Coli d-galactonate:proton symporter in the inward open form (see paper)
22% identity, 91% coverage: 19:427/450 of query aligns to 10:406/409 of 6e9nA
6e9oA E. Coli d-galactonate:proton symporter mutant e133q in the outward substrate-bound form (see paper)
22% identity, 90% coverage: 25:427/450 of query aligns to 19:390/393 of 6e9oA
Q9NRA2 Sialin; H(+)/nitrate cotransporter; H(+)/sialic acid cotransporter; AST; Membrane glycoprotein HP59; Solute carrier family 17 member 5; Vesicular excitatory amino acid transporter; VEAT from Homo sapiens (Human) (see 8 papers)
25% identity, 75% coverage: 39:377/450 of query aligns to 96:407/495 of Q9NRA2
- K136 (≠ R79) to E: in SD; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; completely devoid of L-aspartate and L-glutamate transporter activity, but retains appreciable H(+)-coupled sialic acid transporter activity; dbSNP:rs80338795
- H183 (≠ I133) to R: in ISSD; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; abolishes H(+)-coupled sialic acid transporter activity; has normal L-aspartate and L-glutamate transporter activity; dbSNP:rs119491109
- LL 198:199 (≠ VV 148:149) mutation to AA: Localizes in vesicular structures mainly concentrated in the perinuclear region.
- IL 266:267 (≠ LV 222:223) mutation to LA: Localizes in vesicular structures mainly concentrated in the perinuclear region.
- SSLRN 268:272 (≠ ARQKQ 224:228) natural variant: Missing (in ISSD; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; abolishes H(+)-coupled sialic acid transporter activity; has normal L-aspartate and L-glutamate transporter activity)
- G328 (= G286) to E: in ISSD; some patients may manifest a milder phenotype consistent with Salla disease; markedly decreases H(+)-coupled sialic acid transporter activity; abolishes L-aspartate and L-glutamate transporter activity; dbSNP:rs386833996
- P334 (= P292) to R: in ISSD; does not affect intracellular localization, targeted to lysosomes; abolishes H(+)-coupled sialic acid transporter activity; abolishes L-aspartate and L-glutamate transporter activity; dbSNP:rs119491110
- G371 (= G333) to V: in ISSD; abolishes H(+)-coupled sialic acid transporter activity; abolishes L-aspartate and L-glutamate transporter activity; dbSNP:rs777862172
Sites not aligning to the query:
- 22:23 Dileucine internalization motif; LL→AA: Targeted to plasma membrane.; LL→GG: Targeted to plasma membrane; sialic acid uptake strongly activated at acidic pH.
- 39 R → C: in SD; frequent variant in Finland; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; completely devoid of L-aspartate and L-glutamate transport activity, but retains appreciable H(+)-coupled sialic acid and nitrate transporter activity; dbSNP:rs80338794
Q5Q0U0 Sialin; H(+)/nitrate cotransporter; H(+)/sialic acid cotransporter; AST; Solute carrier family 17 (Anion/sugar transporter), member 5; Vesicular excitatory amino acid transporter; VEAT from Rattus norvegicus (Rat) (see 2 papers)
27% identity, 58% coverage: 117:377/450 of query aligns to 167:407/495 of Q5Q0U0
- R168 (= R118) mutation to C: Abolishes H(+)-coupled sialic acid transporter activity.
- E171 (≠ L121) mutation to C: Decreases H(+)-coupled sialic acid transporter activity; when associated with C-175.
- G172 (= G122) mutation to C: Decreases protein levels and alters subcellular localization.
- E175 (= E125) mutation to C: Decreases H(+)-coupled sialic acid transporter activity; when associated with C-171.
- G176 (≠ A126) mutation to C: Decreases protein levels and alters subcellular localization.
- F179 (= F129) mutation to C: Decreases the affinity and transport rate for D-glucuronate. Does not affect H(+)-coupled sialic acid transporter activity.
- P180 (= P130) mutation to C: Decreases protein levels and alters subcellular localization.
- H183 (≠ I133) mutation to R: Abolishes H(+)-coupled sialic acid transporter activity.
- W186 (≠ L136) mutation to C: Abolishes H(+)-coupled sialic acid transporter activity.
- SSLKN 268:272 (≠ ARQKQ 224:228) mutation Missing: Abolishes H(+)-coupled sialic acid transporter activity.
- P334 (= P292) mutation to R: Abolishes H(+)-coupled sialic acid transporter activity.
- G371 (= G333) mutation to V: Remains in the endoplasmic reticulum.
Sites not aligning to the query:
- 22:23 Dileucine internalization motif; LL→AA: Targeted to plasma membrane; sialic acid uptake strongly activated at acidic pH.
- 39 R→C: Markedly decreases H(+)-coupled sialic acid transporter activity.
- 136 K→E: Markedly decreases H(+)-coupled sialic acid transporter activity.
Q8BN82 Sialin; H(+)/nitrate cotransporter; H(+)/sialic acid cotransporter; AST; Solute carrier family 17 member 5; Vesicular excitatory amino acid transporter; VEAT from Mus musculus (Mouse) (see paper)
26% identity, 58% coverage: 117:377/450 of query aligns to 167:407/495 of Q8BN82
- H183 (≠ I133) mutation to R: Abolishes sialic acid transporter activity. Does not affect L-aspartate and L-glutamate transporter activity.
Sites not aligning to the query:
- 39 R→C: Completely abolishes L-aspartate and L-glutamate transporter activity. Retains appreciable H(+)-coupled sialic acid transporter activity.
Q5EXK5 3-hydroxybenzoate transporter MhbT from Klebsiella oxytoca (see paper)
22% identity, 90% coverage: 19:424/450 of query aligns to 24:430/452 of Q5EXK5
- D82 (≠ E74) mutation to A: Loss of activity.
- V311 (≠ R305) mutation to W: Loss of activity.
- D314 (= D308) mutation to A: Loss of activity.
Q03567 Uncharacterized transporter slc-17.2 from Caenorhabditis elegans (see paper)
25% identity, 53% coverage: 58:294/450 of query aligns to 90:318/493 of Q03567
Sites not aligning to the query:
- 69 modified: carbohydrate, N-linked (GlcNAc...) asparagine
Q9Y2C5 Probable small intestine urate exporter; Solute carrier family 17 member 4 from Homo sapiens (Human) (see 2 papers)
24% identity, 59% coverage: 63:328/450 of query aligns to 122:375/497 of Q9Y2C5
- A372 (= A325) to T: in dbSNP:rs11754288
Sites not aligning to the query:
- 66 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→A: Loss of glycosylation and significant reduction in the transport of thyroid hormones T3 and T4; when associated with A-75 and A-90.
- 75 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→A: Loss of glycosylation and significant reduction in the transport of thyroid hormones T3 and T4; when associated with A-66 and A-90.
- 90 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→A: Loss of glycosylation and significant reduction in the transport of thyroid hormones T3 and T4; when associated with A-75 and A-90.
Query Sequence
>H281DRAFT_00981 FitnessBrowser__Burk376:H281DRAFT_00981
MELEARTMKRVTVRLVPFLIVCYFIAYLDRVNVGFAALQMNKALGLSASAFGFGAGIFFI
AYFFFEVPSNLLLEKFGARRWIARIMFTWGLLAGAMAYIPHIAQYTGLSAAHVFYGLRIL
LGVAEAGFFPGVIFLLTLWFPAAYRGRVVGYFMAAIPLSTVIGGPISGALLSMDGFAGLA
GWQWVYLIEALPALILAFAVWFYLTDKPADATWLAADERDWLVARQKQEREHREAVHAFS
VKEALLNRRVLAIALIYFGANATNYGLSFFLPQIVKAFGLTNLQTGFVTSLPYIVGVISM
VYWGRHSDRKLERKRHVAIALTVAALGIAASAGLDNPVQKMIALSIAGFGIFGCLPVIWT
LPAAFLSGAAAAGGIAAINSLGNLAGFFGPYAMGWIKDSTGGFGAGLLCLAGAGLVGAAA
ALLLHHDPALEASAGTARRDASAGPPVAEY
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory