Comparing H281DRAFT_00991 FitnessBrowser__Burk376:H281DRAFT_00991 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5ktlA Dihydrodipicolinate synthase from the industrial and evolutionarily important cyanobacteria anabaena variabilis. (see paper)
30% identity, 93% coverage: 3:276/295 of query aligns to 5:278/295 of 5ktlA
3lbcD D-sialic acid aldolase complexed with l-arabinose
29% identity, 99% coverage: 2:293/295 of query aligns to 4:295/296 of 3lbcD
2wpbA Crystal structure of the e192n mutant of e. Coli n-acetylneuraminic acid lyase in complex with pyruvate and the inhibitor (2r,3r)-2,3,4- trihydroxy-n,n-dipropylbutanamide in space group p21 crystal form i (see paper)
29% identity, 99% coverage: 2:293/295 of query aligns to 9:300/302 of 2wpbA
1fdzA N-acetylneuraminate lyase in complex with pyruvate via borohydride reduction (see paper)
29% identity, 99% coverage: 2:293/295 of query aligns to 1:292/292 of 1fdzA
1fdyA N-acetylneuraminate lyase in complex with hydroxypyruvate (see paper)
29% identity, 99% coverage: 2:293/295 of query aligns to 1:292/292 of 1fdyA
4dxvA Crystal structure of dihydrodipicolinate synthase from acinetobacter baumannii complexed with mg and cl ions at 1.80 a resolution
31% identity, 73% coverage: 2:215/295 of query aligns to 1:215/291 of 4dxvA
3u8gA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with oxalic acid at 1.80 a resolution
31% identity, 73% coverage: 2:215/295 of query aligns to 1:215/291 of 3u8gA
3tdfA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 2-ketobutanoic acid at 1.99 a resolution
31% identity, 73% coverage: 2:215/295 of query aligns to 1:215/291 of 3tdfA
3tceA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 5-hydroxylysine at 2.6 a resolution
31% identity, 73% coverage: 2:215/295 of query aligns to 1:215/291 of 3tceA
3rk8A Crystal structure of the chloride inhibited dihydrodipicolinate synthase from acinetobacter baumannii complexed with pyruvate at 1.8 a resolution
31% identity, 73% coverage: 2:215/295 of query aligns to 1:215/291 of 3rk8A
Sites not aligning to the query:
3pueB Crystal structure of the complex of dhydrodipicolinate synthase from acinetobacter baumannii with lysine at 2.6a resolution
31% identity, 73% coverage: 2:215/295 of query aligns to 1:215/291 of 3pueB
Sites not aligning to the query:
4bwlC Structure of the y137a mutant of e. Coli n-acetylneuraminic acid lyase in complex with pyruvate, n-acetyl-d-mannosamine and n- acetylneuraminic acid (see paper)
29% identity, 99% coverage: 2:293/295 of query aligns to 4:295/296 of 4bwlC
4bwlA Structure of the y137a mutant of e. Coli n-acetylneuraminic acid lyase in complex with pyruvate, n-acetyl-d-mannosamine and n- acetylneuraminic acid (see paper)
29% identity, 99% coverage: 2:293/295 of query aligns to 6:297/299 of 4bwlA
3na8A Crystal structure of a putative dihydrodipicolinate synthetase from pseudomonas aeruginosa
33% identity, 93% coverage: 2:276/295 of query aligns to 2:276/291 of 3na8A
4ptnA Crystal structure of yage, a kdg aldolase protein in complex with magnesium cation coordinated l-glyceraldehyde (see paper)
28% identity, 95% coverage: 3:281/295 of query aligns to 3:286/298 of 4ptnA
4onvA Crystal structure of yage, a kdg aldolase protein in complex with 2- keto-3-deoxy gluconate
28% identity, 95% coverage: 3:281/295 of query aligns to 3:286/298 of 4onvA
4oe7D Crystal structure of yage, a kdg aldolase protein, in complex with aldol condensed product of pyruvate and glyoxal
28% identity, 95% coverage: 3:281/295 of query aligns to 3:286/298 of 4oe7D
4oe7B Crystal structure of yage, a kdg aldolase protein, in complex with aldol condensed product of pyruvate and glyoxal
28% identity, 95% coverage: 3:281/295 of query aligns to 3:286/298 of 4oe7B
4oe7A Crystal structure of yage, a kdg aldolase protein, in complex with aldol condensed product of pyruvate and glyoxal
28% identity, 95% coverage: 3:281/295 of query aligns to 3:286/298 of 4oe7A
3nevA Crystal structure of yage, a prophage protein from e. Coli k12 in complex with kdgal (see paper)
28% identity, 95% coverage: 3:281/295 of query aligns to 3:286/298 of 3nevA
>H281DRAFT_00991 FitnessBrowser__Burk376:H281DRAFT_00991
MSFEGVHTPLVTPFKADGEIDHTLLGKHAVNLAGRVAGLGVGGTTGEYYALSFDERVQTF
NTVAEAAGGKTYLTAGINATTTKEVIRLGQEAKRAGLNALLLAAPYYAQPTQDELLSHLL
KVDDSLDMPVMLYNFPARTGTHIGDNVLSKLLERPNFIAMKESTGDISHLHHLATHFRDR
LVLSCGMDDQALEFFVWGAKSWVGGASNFLPEAHTALLDACVKHGDFATGRKLMAQLLPV
LELLERSGKFIQYVRYGCELAGTPVGVARAPLGTLDENERSGFAKLVRPLLSNAQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory