Comparing H281DRAFT_01051 FitnessBrowser__Burk376:H281DRAFT_01051 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1tmxA Crystal structure of hydroxyquinol 1,2-dioxygenase from nocardioides simplex 3e (see paper)
55% identity, 97% coverage: 6:282/286 of query aligns to 12:289/292 of 1tmxA
Q5PXQ6 Hydroxyquinol 1,2-dioxygenase; 1,2-HQD; EC 1.13.11.37 from Nocardioides simplex (Arthrobacter simplex) (see paper)
55% identity, 97% coverage: 6:282/286 of query aligns to 13:290/293 of Q5PXQ6
3n9tA Cryatal structure of hydroxyquinol 1,2-dioxygenase from pseudomonas putida dll-e4
48% identity, 97% coverage: 6:282/286 of query aligns to 5:283/286 of 3n9tA
P07773 Catechol 1,2-dioxygenase; 1,2-CTD; EC 1.13.11.1 from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) (see paper)
29% identity, 92% coverage: 22:284/286 of query aligns to 27:294/311 of P07773
1dmhA Structure of catechol 1,2-dioxygenase from acinetobacter sp. Adp1 with bound 4-methylcatechol (see paper)
29% identity, 92% coverage: 22:284/286 of query aligns to 25:292/309 of 1dmhA
1dltA Structure of catechol 1,2-dioxygenase from acinetobacter sp. Adp1 with bound catechol (see paper)
29% identity, 92% coverage: 22:284/286 of query aligns to 25:292/309 of 1dltA
1dlmA Structure of catechol 1,2-dioxygenase from acinetobacter calcoaceticus native data (see paper)
29% identity, 92% coverage: 22:284/286 of query aligns to 25:292/309 of 1dlmA
3th1A Crystal structure of chlorocatechol 1,2-dioxygenase from pseudomonas putida
30% identity, 91% coverage: 24:284/286 of query aligns to 4:246/246 of 3th1A
5umhB Crystal structure of catechol 1,2-dioxygenase protein from burkholderia multivorans
31% identity, 92% coverage: 20:282/286 of query aligns to 24:289/310 of 5umhB
2azqA Crystal structure of catechol 1,2-dioxygenase from pseudomonas arvilla c-1 (see paper)
31% identity, 88% coverage: 32:283/286 of query aligns to 32:289/309 of 2azqA
5td3A Crystal structure of catechol 1,2-dioxygenase from burkholderia vietnamiensis
30% identity, 92% coverage: 22:283/286 of query aligns to 25:289/307 of 5td3A
3o6rA Crystal structure of 4-chlorocatechol dioxygenase from rhodococcus opacus 1cp in complex with pyrogallol (see paper)
31% identity, 81% coverage: 21:252/286 of query aligns to 1:231/256 of 3o6rA
3o6jA Crystal structure of 4-chlorocatechol dioxygenase from rhodococcus opacus 1cp in complex with hydroxyquinol (see paper)
31% identity, 81% coverage: 21:252/286 of query aligns to 1:231/256 of 3o6jA
3o32A Crystal structure of 4-chlorocatechol dioxygenase from rhodococcus opacus 1cp in complex with 3,5-dichlorocatechol (see paper)
31% identity, 81% coverage: 21:252/286 of query aligns to 1:231/256 of 3o32A
2boyA Crystal structure of 3-chlorocatechol 1,2-dioxygenase from rhodococcus opacus 1cp (see paper)
28% identity, 81% coverage: 21:252/286 of query aligns to 1:228/253 of 2boyA
5vxtB Crystal structure of catechol 1,2-dioxygenase from burkholderia ambifaria
30% identity, 91% coverage: 24:283/286 of query aligns to 31:293/312 of 5vxtB
3i51A Crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with 4,5-dichlorocatechol (see paper)
28% identity, 82% coverage: 21:254/286 of query aligns to 6:236/256 of 3i51A
3i4yA Crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with 3,5-dichlorocatechol (see paper)
28% identity, 82% coverage: 21:254/286 of query aligns to 6:236/256 of 3i4yA
3i4vA Crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with 3-chlorocatechol (see paper)
28% identity, 82% coverage: 21:254/286 of query aligns to 6:236/256 of 3i4vA
3hjsA Crystal structure of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with 4-methylcatechol (see paper)
28% identity, 82% coverage: 21:254/286 of query aligns to 6:236/256 of 3hjsA
>H281DRAFT_01051 FitnessBrowser__Burk376:H281DRAFT_01051
MRNLDENTITDAVLKRHEGASNVRLRAVMTSLVRHLHDFAREVQLTEDEWEAGIRFLTEV
GHITDGNRQEFILLSDTLGLSMLVTAMANRKPVGCTEATVFGPFFVGGAPVHRNGDDIAN
GAGGEPCFVSGRIMGLEGEAVPNARIEVWQADSAGFYDVQYEGDTHRARAVLHSLPDGSY
HFRSIVAEPYPIPHDGPVGKLLAALGRHPWRPAHLHFMITAPGYERLVTHVFRDGDRYLD
SDAVFGVRSSLIADWIHHEEGVAPDGTRMQSPFSTLAFDFVLNRSS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory