SitesBLAST
Comparing H281DRAFT_01054 FitnessBrowser__Burk376:H281DRAFT_01054 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6ie0B X-ray crystal structure of 2r,3r-butanediol dehydrogenase from bacillus subtilis
39% identity, 99% coverage: 1:354/356 of query aligns to 2:347/347 of 6ie0B
1e3jA Ketose reductase (sorbitol dehydrogenase) from silverleaf whitefly (see paper)
31% identity, 96% coverage: 10:352/356 of query aligns to 11:345/348 of 1e3jA
- active site: C38 (= C38), G39 (= G39), S40 (≠ T40), H43 (= H43), H63 (= H70), E64 (= E71), C93 (= C100), C96 (= C103), C99 (= C106), C107 (= C114), T111 (≠ G118), P150 (= P157), G154 (≠ A161), K341 (= K348)
- binding phosphate ion: A174 (= A181), A196 (≠ E204), R197 (≠ P205), S198 (≠ N206), R201 (= R209)
- binding zinc ion: C38 (= C38), H63 (= H70), E64 (= E71), C93 (= C100), C96 (= C103), C99 (= C106), C107 (= C114)
1pl6A Human sdh/nadh/inhibitor complex (see paper)
31% identity, 98% coverage: 7:354/356 of query aligns to 14:352/356 of 1pl6A
- active site: C44 (= C38), G45 (= G39), S46 (≠ T40), H49 (= H43), H69 (= H70), E70 (= E71), R99 (≠ C100), D102 (≠ C103), C105 (= C106), S113 (≠ C114), F117 (≠ G118), P156 (= P157), G160 (≠ A161), K344 (= K346)
- binding 4-[2-(hydroxymethyl)pyrimidin-4-yl]-n,n-dimethylpiperazine-1-sulfonamide: C44 (= C38), S46 (≠ T40), I56 (= I50), F59 (vs. gap), H69 (= H70), E155 (= E156), L274 (= L274), F297 (≠ W297)
- binding nicotinamide-adenine-dinucleotide: G181 (= G182), P182 (= P183), I183 (= I184), D203 (≠ E204), L204 (≠ P205), R208 (= R209), C249 (= C249), T250 (≠ S250), V272 (≠ A272), G273 (= G273), L274 (= L274), F297 (≠ W297), R298 (≠ C298)
- binding zinc ion: C44 (= C38), H69 (= H70)
Q00796 Sorbitol dehydrogenase; SDH; (R,R)-butanediol dehydrogenase; L-iditol 2-dehydrogenase; Polyol dehydrogenase; Ribitol dehydrogenase; RDH; Xylitol dehydrogenase; XDH; EC 1.1.1.-; EC 1.1.1.4; EC 1.1.1.14; EC 1.1.1.56; EC 1.1.1.9 from Homo sapiens (Human) (see 10 papers)
31% identity, 98% coverage: 7:354/356 of query aligns to 15:353/357 of Q00796
- C45 (= C38) binding
- H70 (= H70) binding
- E71 (= E71) binding
- R110 (≠ M110) to P: in SORDD; results in protein aggregation
- H135 (≠ L135) to R: in SORDD; results in protein aggregation
- A153 (= A153) to D: in SORDD; uncertain significance; results in protein aggregation; dbSNP:rs145813597
- I184 (= I184) binding
- D204 (≠ E204) binding
- R209 (= R209) binding
- Q239 (≠ L237) to L: in dbSNP:rs1042079
- N269 (≠ A268) to T: in dbSNP:rs930337
- VGL 273:275 (≠ AGL 272:274) binding
- VFR 297:299 (≠ TWC 296:298) binding
- V322 (≠ I322) to I: in SORDD; uncertain significance; dbSNP:rs149975952
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
3qe3A Sheep liver sorbitol dehydrogenase (see paper)
33% identity, 97% coverage: 7:352/356 of query aligns to 9:343/351 of 3qe3A
- active site: C39 (= C38), G40 (= G39), S41 (≠ T40), H44 (= H43), H64 (= H70), E65 (= E71), R94 (≠ C100), D97 (≠ C103), C100 (= C106), S108 (≠ C114), F112 (≠ G118), P151 (= P157), G155 (≠ A161), K339 (= K348)
- binding glycerol: Y45 (≠ E44), F54 (vs. gap), T116 (≠ L122), R293 (≠ C298)
- binding zinc ion: C39 (= C38), H64 (= H70), E65 (= E71)
P07846 Sorbitol dehydrogenase; SDH; L-iditol 2-dehydrogenase; Polyol dehydrogenase; Xylitol dehydrogenase; XDH; EC 1.1.1.-; EC 1.1.1.14; EC 1.1.1.9 from Ovis aries (Sheep) (see paper)
32% identity, 97% coverage: 7:352/356 of query aligns to 13:346/354 of P07846
- C43 (= C38) binding
- Y49 (≠ E44) binding
- H67 (= H70) binding
- E68 (= E71) binding
- E153 (= E156) binding
- R296 (≠ C298) binding
- Y297 (= Y299) binding
P27867 Sorbitol dehydrogenase; SDH; L-iditol 2-dehydrogenase; Polyol dehydrogenase; Xylitol dehydrogenase; XDH; EC 1.1.1.-; EC 1.1.1.14; EC 1.1.1.9 from Rattus norvegicus (Rat) (see paper)
30% identity, 98% coverage: 7:354/356 of query aligns to 15:353/357 of P27867
4ejmA Crystal structure of a putative zinc-binding dehydrogenase (target psi-012003) from sinorhizobium meliloti 1021 bound to NADP
31% identity, 99% coverage: 1:353/356 of query aligns to 4:342/342 of 4ejmA
- active site: C40 (= C38), G41 (= G39), T42 (= T40), H45 (= H43), H61 (= H70), E62 (= E71), C91 (= C100), C94 (= C103), C97 (= C106), C105 (= C114), R109 (≠ G118), P147 (= P157), C151 (≠ A161), K337 (= K348)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G170 (= G180), G172 (= G182), V173 (≠ P183), I174 (= I184), T194 (≠ E204), R195 (≠ P205), Q196 (≠ N206), K199 (≠ R209), C240 (= C249), E245 (≠ H254), T246 (≠ A255), L263 (≠ A272), V265 (≠ L274), I291 (≠ C298)
- binding zinc ion: C91 (= C100), C94 (= C103), C97 (= C106), C105 (= C114)
4ej6A Crystal structure of a putative zinc-binding dehydrogenase (target psi-012003) from sinorhizobium meliloti 1021
31% identity, 99% coverage: 1:354/356 of query aligns to 4:343/343 of 4ej6A
- active site: C40 (= C38), G41 (= G39), T42 (= T40), H45 (= H43), H61 (= H70), E62 (= E71), C91 (= C100), C94 (= C103), C97 (= C106), C105 (= C114), R109 (≠ G118), P147 (= P157), C151 (≠ A161), K337 (= K348)
- binding zinc ion: C91 (= C100), C94 (= C103), C97 (= C106), C105 (= C114)
5vm2A Crystal structure of eck1772, an oxidoreductase/dehydrogenase of unknown specificity involved in membrane biogenesis from escherichia coli
28% identity, 89% coverage: 26:342/356 of query aligns to 27:335/347 of 5vm2A
- active site: C39 (= C38), G40 (= G39), S41 (≠ T40), H44 (= H43), H65 (= H70), E66 (= E71), C95 (= C100), C98 (= C103), C101 (= C106), C109 (= C114), D113 (≠ G118), P153 (= P157), G157 (≠ A161)
- binding magnesium ion: H65 (= H70), E66 (= E71), E152 (= E156)
- binding zinc ion: C95 (= C100), C98 (= C103), C101 (= C106), C109 (= C114)
Sites not aligning to the query:
O58389 L-threonine 3-dehydrogenase; L-ThrDH; TDH; L-threonine dehydrogenase; EC 1.1.1.103 from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 2 papers)
33% identity, 91% coverage: 16:339/356 of query aligns to 23:335/348 of O58389
- C42 (= C38) binding
- T44 (= T40) mutation to A: Total loss of enzymatic activity.
- H67 (= H70) binding
- E68 (= E71) binding
- C97 (= C100) binding
- C100 (= C103) binding
- C103 (= C106) binding
- C111 (= C114) binding
- E152 (= E156) mutation E->A,Q: Almost complete loss of enzymatic activity.; mutation to C: 120-fold decrease in catalytic efficiency.; mutation to D: Shows 3-fold higher turnover rate and reduced affinities toward L-threonine and NAD(+), compared to wild-type.; mutation to K: Total loss of enzymatic activity.
- L179 (≠ I184) binding
- E199 (= E204) binding ; mutation to A: Large decrease in affinity for NAD(+).
- R204 (= R209) binding ; mutation to A: Large decrease in affinity for NAD(+).
- LGL 266:268 (≠ AGL 272:274) binding
- IT 291:292 (≠ -T 296) binding
- R294 (≠ C298) mutation to A: 4000-fold decrease in catalytic efficiency.
2dfvA Hyperthermophilic threonine dehydrogenase from pyrococcus horikoshii (see paper)
33% identity, 91% coverage: 16:339/356 of query aligns to 21:333/346 of 2dfvA
- active site: C40 (= C38), G41 (= G39), T42 (= T40), H45 (= H43), H65 (= H70), E66 (= E71), C95 (= C100), C98 (= C103), C101 (= C106), C109 (= C114), K113 (≠ G118), P151 (= P157), A155 (= A161)
- binding nicotinamide-adenine-dinucleotide: G175 (= G182), P176 (= P183), L177 (≠ I184), E197 (= E204), P198 (= P205), R202 (= R209), F241 (≠ C249), S242 (= S250), A244 (≠ N252), L264 (≠ A272), G265 (= G273), L266 (= L274), I289 (vs. gap), T290 (= T296)
- binding zinc ion: C95 (= C100), C101 (= C106), C109 (= C114)
Sites not aligning to the query:
P07913 L-threonine 3-dehydrogenase; TDH; L-threonine dehydrogenase; EC 1.1.1.103 from Escherichia coli (strain K12) (see paper)
29% identity, 99% coverage: 1:352/356 of query aligns to 1:339/341 of P07913
- C38 (= C38) mutation to D: Shows only 1% of wild-type catalytic activity. This mutant can be stimulated to the wild-type activity level after incubation with Zn(+).; mutation to S: Loss of catalytic activity. This mutant cannot be stimulated to the wild-type activity level after incubation with Zn(+).
3gfbA L-threonine dehydrogenase (tktdh) from the hyperthermophilic archaeon thermococcus kodakaraensis (see paper)
31% identity, 95% coverage: 16:354/356 of query aligns to 21:346/347 of 3gfbA
- active site: C40 (= C38), G41 (= G39), T42 (= T40), H45 (= H43), H65 (= H70), E66 (= E71), C95 (= C100), C98 (= C103), C101 (= C106), C109 (= C114), K113 (≠ G118), P151 (= P157), A155 (= A161), K340 (= K348)
- binding nicotinamide-adenine-dinucleotide: G173 (= G180), G175 (= G182), P176 (= P183), L177 (≠ I184), S196 (= S203), E197 (= E204), P198 (= P205), R202 (= R209), F241 (≠ C249), S242 (= S250), A244 (≠ N252), L264 (≠ A272), G265 (= G273), L266 (= L274), I289 (vs. gap), T290 (= T296)
Q5JI69 L-threonine 3-dehydrogenase; TDH; L-threonine dehydrogenase; EC 1.1.1.103 from Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) (Pyrococcus kodakaraensis (strain KOD1)) (see paper)
31% identity, 95% coverage: 16:354/356 of query aligns to 23:348/350 of Q5JI69
B6HI95 L-arabinitol 4-dehydrogenase; LAD; EC 1.1.1.12 from Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) (Penicillium chrysogenum) (see paper)
29% identity, 95% coverage: 15:351/356 of query aligns to 31:369/385 of B6HI95
- DI 212:213 (≠ EP 204:205) mutation to SR: Alters cofactor specificity from NAD to NADP; when associated with T-358.
- S358 (= S340) mutation to T: Alters cofactor specificity from NAD to NADP; when associated with 212-SR-213.
3m6iA L-arabinitol 4-dehydrogenase (see paper)
29% identity, 89% coverage: 36:352/356 of query aligns to 47:356/358 of 3m6iA
- active site: C49 (= C38), G50 (= G39), S51 (≠ T40), H54 (= H43), H74 (= H70), E75 (= E71), C104 (= C100), C107 (= C103), C110 (= C106), C118 (= C114), D122 (≠ G118), P160 (= P157), A164 (= A161), K352 (= K348)
- binding nicotinamide-adenine-dinucleotide: C49 (= C38), V163 (= V160), G185 (= G182), P186 (= P183), I187 (= I184), D207 (≠ E204), R212 (= R209), C255 (= C249), T256 (≠ S250), I278 (≠ A272), G279 (= G273), V280 (≠ L274), R304 (≠ C298)
- binding zinc ion: C49 (= C38), H74 (= H70), C104 (= C100), C107 (= C103), C110 (= C106), C118 (= C114)
Q7SI09 L-arabinitol 4-dehydrogenase; LAD; EC 1.1.1.12 from Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) (see 2 papers)
29% identity, 89% coverage: 36:352/356 of query aligns to 51:360/363 of Q7SI09
- C53 (= C38) binding
- F59 (≠ E44) mutation F->A,S,Y: No effect.
- H78 (= H70) binding
- E79 (= E71) binding
- C108 (= C100) binding
- C111 (= C103) binding
- C114 (= C106) binding
- C122 (= C114) binding
- E163 (= E156) binding
- PI 190:191 (= PI 183:184) binding
- D211 (≠ E204) binding
- DI 211:212 (≠ EP 204:205) mutation to SR: Alters cofactor specificity from NAD to NADP; when associated with T-348.
- R216 (= R209) binding
- I282 (≠ A272) binding
- QYR 306:308 (≠ TWC 296:298) binding
- S348 (= S340) mutation to T: Alters cofactor specificity from NAD to NADP; when associated with 211-SR-212.
2ejvA Crystal structure of threonine 3-dehydrogenase complexed with NAD+
31% identity, 95% coverage: 17:354/356 of query aligns to 20:342/343 of 2ejvA
- active site: C38 (= C38), G39 (= G39), T40 (= T40), H43 (= H43), H63 (= H70), E64 (= E71), C93 (= C100), C96 (= C103), C99 (= C106), C107 (= C114), Q111 (≠ G118), P149 (= P157), A153 (= A161), K336 (= K348)
- binding nicotinamide-adenine-dinucleotide: G172 (= G180), G174 (= G182), P175 (= P183), I176 (= I184), S195 (= S203), D196 (≠ E204), P197 (= P205), R201 (= R209), F238 (≠ C249), S239 (= S250), N241 (= N252), A244 (= A255), L261 (≠ A272), G262 (= G273), I263 (≠ L274)
- binding zinc ion: C38 (= C38), H63 (= H70), E64 (= E71), C96 (= C103), C99 (= C106), C107 (= C114)
2dq4A Crystal structure of threonine 3-dehydrogenase
31% identity, 95% coverage: 17:354/356 of query aligns to 20:342/343 of 2dq4A
- active site: C38 (= C38), G39 (= G39), T40 (= T40), H43 (= H43), H63 (= H70), E64 (= E71), C93 (= C100), C96 (= C103), C99 (= C106), C107 (= C114), Q111 (≠ G118), P149 (= P157), A153 (= A161), K336 (= K348)
- binding zinc ion: C38 (= C38), H63 (= H70), E64 (= E71), C93 (= C100), C96 (= C103), C107 (= C114)
Query Sequence
>H281DRAFT_01054 FitnessBrowser__Burk376:H281DRAFT_01054
MRAVRFHCAHDIRVENVPDPSGIGADQMIVKPMWCGICGTDLHEYQAGPIVVPTEPHPLT
GAKAPQVLGHEFSAEVLEVGRDVKNVRAGDRISVMPLASCGQCYYCVRGMRHLCTKMGCV
GLSWDGGGMAEYTVLNDYHANRLPDNVSDKQGALIEPAAVALYAVDRGGVTVGSSVLITG
AGPIGVLAALACHAAGASQIFVSEPNPARAAKMSEFGVTTQIFDPTEGELPERIRDLTEG
VGVDVAIECSGNQHALNACVDAVRSAGAVVQAGLHVGTATVDPMKWSLKDIHIEGTWCYP
VTIWPRIIGMIANGKFPVEKLIHDLIDADDVVAKGFDALSDKGGDKMKILINPQTT
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory