Comparing H281DRAFT_01076 FitnessBrowser__Burk376:H281DRAFT_01076 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 1 hits to proteins with known functional sites (download)
2gbxD Crystal structure of biphenyl 2,3-dioxygenase from sphingomonas yanoikuyae b1 bound to biphenyl (see paper)
31% identity, 73% coverage: 1:119/162 of query aligns to 8:124/170 of 2gbxD
Sites not aligning to the query:
>H281DRAFT_01076 FitnessBrowser__Burk376:H281DRAFT_01076
MNFDYQKVCRALYQEARFLDDRQWDEWLACYTEDVTYWMPAWDDDDSLTEDPQTQISLMY
YPDRGGLEDRVFRIKTERSGASMPEPRTSHNVTNVEVLVERDGEVDLRYNFNTLIHRYRI
TDQFFGTMYVTLRKVDDRLLIASKKIALKNDYIRQVLDVYHV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory