Comparing H281DRAFT_01080 FitnessBrowser__Burk376:H281DRAFT_01080 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 10 hits to proteins with known functional sites (download)
7d50B Spua mutant - h221n with glutamyl-thioester (see paper)
55% identity, 96% coverage: 1:247/256 of query aligns to 6:251/255 of 7d50B
7d53A Spua mutant - h221n with glu (see paper)
56% identity, 95% coverage: 5:247/256 of query aligns to 4:245/249 of 7d53A
7d4rB Spua native structure (see paper)
49% identity, 95% coverage: 5:247/256 of query aligns to 2:213/215 of 7d4rB
6vtvB Crystal structure of puud gamma-glutamyl-gamma-aminobutyrate hydrolase from e. Coli
41% identity, 98% coverage: 1:252/256 of query aligns to 2:250/252 of 6vtvB
P76038 Gamma-glutamyl-gamma-aminobutyrate hydrolase PuuD; Gamma-Glu-GABA hydrolase; EC 3.5.1.94 from Escherichia coli (strain K12) (see paper)
41% identity, 98% coverage: 1:252/256 of query aligns to 4:252/254 of P76038
O33341 Putative glutamine amidotransferase Rv2859c; EC 2.4.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
37% identity, 95% coverage: 3:244/256 of query aligns to 64:295/308 of O33341
3fijA Crystal structure of a uncharacterized protein lin1909
32% identity, 96% coverage: 4:248/256 of query aligns to 2:224/224 of 3fijA
P49915 GMP synthase [glutamine-hydrolyzing]; GMP synthetase; Glutamine amidotransferase; EC 6.3.5.2 from Homo sapiens (Human) (see paper)
36% identity, 28% coverage: 101:172/256 of query aligns to 92:163/693 of P49915
Sites not aligning to the query:
2vxoB Human gmp synthetase in complex with xmp (see paper)
40% identity, 28% coverage: 101:172/256 of query aligns to 70:138/658 of 2vxoB
Sites not aligning to the query:
1vcnA Crystal structure of t.Th. Hb8 ctp synthetase complex with sulfate anion (see paper)
32% identity, 47% coverage: 107:226/256 of query aligns to 358:485/506 of 1vcnA
Sites not aligning to the query:
>H281DRAFT_01080 FitnessBrowser__Burk376:H281DRAFT_01080
MRNKPLIGITADRTTTGHHPSHVVGEKYIAAIVDGSQALALLLPALGERQSTEDVLASVD
GLFFTGSYSNLEPHRYGGKPCAPDTLHDAARDATTLPLMRAAIAAGVPVLAVCRGLQEMN
VVFGGTLHQSVHAVAGFSDHRENKEDRLDLQYAPSHTVLLTHGGLLQRLAHGANEVRVNS
LHDQGIEQLGMGLVVEATAPDGLIEAVSVSGARAFALGVQWHPEWKHASDLLSTAIFRAF
GNACRERMRAKRENWL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory