Comparing H281DRAFT_01082 FitnessBrowser__Burk376:H281DRAFT_01082 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7q9xAAA Probable aminotransferase
62% identity, 93% coverage: 26:469/478 of query aligns to 1:443/455 of 7q9xAAA
4a6tC Crystal structure of the omega transaminase from chromobacterium violaceum in complex with plp (see paper)
62% identity, 93% coverage: 26:469/478 of query aligns to 1:443/455 of 4a6tC
6s4gA Crystal structure of the omega transaminase from chromobacterium violaceum in complex with pmp (see paper)
62% identity, 93% coverage: 27:469/478 of query aligns to 1:442/453 of 6s4gA
4ba5A Crystal structure of omega-transaminase from chromobacterium violaceum (see paper)
62% identity, 87% coverage: 54:469/478 of query aligns to 1:415/427 of 4ba5A
7qx0B Transaminase structure of plurienzyme (tr2e2) in complex with plp (see paper)
55% identity, 94% coverage: 27:476/478 of query aligns to 1:443/443 of 7qx0B
4a6rA Crystal structure of the omega transaminase from chromobacterium violaceum in the apo form, crystallised from polyacrylic acid (see paper)
62% identity, 87% coverage: 55:469/478 of query aligns to 1:411/423 of 4a6rA
6gwiB The crystal structure of halomonas elongata amino-transferase (see paper)
55% identity, 94% coverage: 28:475/478 of query aligns to 3:449/450 of 6gwiB
7qx3A Structure of the transaminase tr2e2 with eos (see paper)
56% identity, 88% coverage: 54:476/478 of query aligns to 1:422/422 of 7qx3A
5ti8B Crystal structure of an aspartate aminotransferase from pseudomonas (see paper)
55% identity, 87% coverage: 55:472/478 of query aligns to 1:380/384 of 5ti8B
7ypmA Crystal structure of transaminase cc1012 complexed with plp and l- alanine (see paper)
51% identity, 92% coverage: 29:469/478 of query aligns to 4:445/454 of 7ypmA
7ypnD Crystal structure of transaminase cc1012 mutant m9 complexed with plp (see paper)
51% identity, 92% coverage: 29:469/478 of query aligns to 4:445/455 of 7ypnD
6io1B Crystal structure of a novel thermostable (s)-enantioselective omega- transaminase from thermomicrobium roseum (see paper)
42% identity, 92% coverage: 29:469/478 of query aligns to 6:444/448 of 6io1B
5kr6B Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
42% identity, 94% coverage: 28:475/478 of query aligns to 6:460/460 of 5kr6B
5ghgB Transaminase w58l with smba
40% identity, 92% coverage: 33:474/478 of query aligns to 6:433/433 of 5ghgB
6g4fA Crystal structure of the omega transaminase from pseudomonas jessenii in complex with pmp (see paper)
40% identity, 92% coverage: 35:476/478 of query aligns to 7:450/451 of 6g4fA
6g4eA Crystal structure of the omega transaminase from pseudomonas jessenii in complex with plp and 6-aminohexanoate (6-aca) (see paper)
40% identity, 92% coverage: 35:476/478 of query aligns to 7:450/451 of 6g4eA
6g4dB Crystal structure of the omega transaminase from pseudomonas jessenii in complex with plp (see paper)
40% identity, 92% coverage: 35:476/478 of query aligns to 7:450/453 of 6g4dB
5kquC Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
41% identity, 92% coverage: 35:475/478 of query aligns to 11:458/459 of 5kquC
5kr5A Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
40% identity, 92% coverage: 34:472/478 of query aligns to 8:453/455 of 5kr5A
5kr3A Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
39% identity, 92% coverage: 34:475/478 of query aligns to 11:457/458 of 5kr3A
>H281DRAFT_01082 FitnessBrowser__Burk376:H281DRAFT_01082
MSYRTEEIAYMQPAEPAAGARTAQQRTTAEYRALDAAHHIHPFSDMGELNRSGSRVIVRA
HGVYLWDSEGNKIIDGMAGLWCVNVGYGRKELANAAYRQMEELPYYNTFFKTTHPPVIEL
SALLAELAPEPFNHFFYCNSGSEANDTVLRIVHRYWTTQGKHSKKVVISRRNGYHGSTIA
GGTLGGMGYMHEQMPSKVENIVHIDQPYFFAEANSSQTPEEFALARAQQLEMKILEIGAH
NVAAFIGEPFQGAGGVIFPASTYWPEIERICRKYDVLLVADEVIGGFGRTGEWFAHQHFG
FQPDLITMAKGLTSGYVPMGAVGLNDRIAKAIIENGEFNHGLTYSGHPVAAAVAVANLKL
LRDEKIVERVKTDTGPYFQKKLRDTFARHPIVGEIAGAGLVAGLQLAEEPASRKRFANGG
DVGGVCRDFCFNGNLIMRASGDRMLLSPPLVISKQEIDDLVSKAKNAIDATATQLGIS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory