Comparing H281DRAFT_01114 FitnessBrowser__Burk376:H281DRAFT_01114 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5hqjA Crystal structure of abc transporter solute binding protein b1g1h7 from burkholderia graminis c4d1m, target efi-511179, in complex with d-arabinose
30% identity, 73% coverage: 32:274/334 of query aligns to 9:251/289 of 5hqjA
4wzzA Crystal structure of an abc transporter solute binding protein (ipr025997) from clostridium phytofermentas (cphy_0583, target efi- 511148) with bound l-rhamnose
26% identity, 87% coverage: 26:316/334 of query aligns to 2:303/321 of 4wzzA
4pz0A The crystal structure of a solute binding protein from bacillus anthracis str. Ames in complex with quorum-sensing signal autoinducer-2 (ai-2)
26% identity, 89% coverage: 34:329/334 of query aligns to 13:321/321 of 4pz0A
3c6qC Apo and ligand-bound form of a thermophilic glucose/xylose binding protein
28% identity, 77% coverage: 42:299/334 of query aligns to 14:286/305 of 3c6qC
Sites not aligning to the query:
2h3hA Crystal structure of the liganded form of thermotoga maritima glucose binding protein (see paper)
28% identity, 77% coverage: 42:299/334 of query aligns to 14:286/313 of 2h3hA
Sites not aligning to the query:
6guqA Crystal structure of ganp, a glucose-galactose binding protein from geobacillus stearothermophilus, in complex with glucose
27% identity, 75% coverage: 41:290/334 of query aligns to 14:260/278 of 6guqA
Sites not aligning to the query:
6gt9A Crystal structure of ganp, a glucose-galactose binding protein from geobacillus stearothermophilus, in complex with galactose
27% identity, 75% coverage: 41:290/334 of query aligns to 19:265/283 of 6gt9A
Sites not aligning to the query:
4wutA Crystal structure of an abc transporter solute binding protein (ipr025997) from agrobacterium vitis (avi_5133, target efi-511220) with bound d-fucose
27% identity, 86% coverage: 29:315/334 of query aligns to 2:289/290 of 4wutA
1tjyA Crystal structure of salmonella typhimurium ai-2 receptor lsrb in complex with r-thmf (see paper)
24% identity, 92% coverage: 29:334/334 of query aligns to 4:316/316 of 1tjyA
8wlbA X-ray structure of enterobacter cloacae allose-binding protein in complex with d-psicose (see paper)
29% identity, 71% coverage: 34:270/334 of query aligns to 7:249/288 of 8wlbA
8wl9A X-ray structure of enterobacter cloacae allose-binding protein in complex with d-ribose (see paper)
29% identity, 71% coverage: 34:270/334 of query aligns to 7:249/288 of 8wl9A
5dteB Crystal structure of an abc transporter periplasmic solute binding protein (ipr025997) from actinobacillus succinogenes 130z(asuc_0081, target efi-511065) with bound d-allose
29% identity, 76% coverage: 31:284/334 of query aligns to 5:263/287 of 5dteB
1rpjA Crystal structure of d-allose binding protein from escherichia coli (see paper)
28% identity, 71% coverage: 34:270/334 of query aligns to 7:249/288 of 1rpjA
1gudA Hinge-bending motion of d-allose binding protein from escherichia coli: three open conformations (see paper)
28% identity, 71% coverage: 34:270/334 of query aligns to 7:249/288 of 1gudA
Sites not aligning to the query:
3t95A Crystal structure of lsrb from yersinia pestis complexed with autoinducer-2 (see paper)
23% identity, 92% coverage: 29:334/334 of query aligns to 2:314/314 of 3t95A
6dspA Lsrb from clostridium saccharobutylicum in complex with ai-2 (see paper)
23% identity, 81% coverage: 30:299/334 of query aligns to 2:281/326 of 6dspA
7x0hA Crystal structure of sugar binding protein cbpa complexed wtih glucose from clostridium thermocellum (see paper)
33% identity, 41% coverage: 34:169/334 of query aligns to 13:149/287 of 7x0hA
Sites not aligning to the query:
3ejwA Crystal structure of the sinorhizobium meliloti ai-2 receptor, smlsrb (see paper)
24% identity, 83% coverage: 31:307/334 of query aligns to 4:280/315 of 3ejwA
4rxtA Crystal structure of carbohydrate transporter solute binding protein arad_9553 from agrobacterium radiobacter, target efi-511541, in complex with d-arabinose
26% identity, 83% coverage: 30:307/334 of query aligns to 6:286/295 of 4rxtA
5dkvA Crystal structure of an abc transporter solute binding protein from agrobacterium vitis(avis_5339, target efi-511225) bound with alpha-d- tagatopyranose
28% identity, 57% coverage: 75:263/334 of query aligns to 52:248/303 of 5dkvA
Sites not aligning to the query:
>H281DRAFT_01114 FitnessBrowser__Burk376:H281DRAFT_01114
MKLTRLGAALAAAALTVGVIAAAQAATNETIVTVVKVTGINWFNRMDEGVKEFAKDNPGV
TAYQTGPGRADAAQQLKIIEDLIAKKVNAIAVVPYDPPTLEPALKKAMDRGIKVVTHEAD
NAKNTMVDIEAFDNTAYGAGLNERLASCMHNEGKWAVLVGSLGSRSQVQWADGGIGNAKA
KYAKMNLVEPKLETNNDGERAYEVAKEVLRKHPDLKGFQGSSSLDVIGIGRAVEEAGMQG
KICVYGTGLPTEAGKFLESGAINGIAFWDPKLAGIAMNKVAKMLVDGKTVENGADLGIPG
YTKVTVAKGPGKGIIVRGQGWVNVDKSNYKQYPF
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory