SitesBLAST
Comparing H281DRAFT_01131 FitnessBrowser__Burk376:H281DRAFT_01131 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7v0hG Crystal structure of putative glucose 1-dehydrogenase from burkholderia cenocepacia in complex with NADP and a potential reaction product
75% identity, 99% coverage: 1:246/248 of query aligns to 6:251/253 of 7v0hG
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G13), S20 (= S15), K21 (= K16), G22 (= G17), I23 (= I18), A43 (= A38), S44 (= S39), S45 (= S40), G68 (= G63), D69 (= D64), V70 (= V65), N96 (= N91), S97 (= S92), G98 (= G93), Y100 (= Y95), I144 (≠ V139), S146 (= S141), Y159 (= Y154), K163 (= K158), P189 (= P184), G190 (= G185), M191 (= M186), I192 (≠ V187), T194 (= T189), G196 (= G191), T197 (= T192)
- binding (2R)-2-(hydroxymethyl)pentanedioic acid: S146 (= S141), Y159 (= Y154), M191 (= M186), I202 (≠ F197)
8hfkA Crystal structure of cbar mutant (h162f) in complex with NADP+ and halogenated aryl ketone (see paper)
40% identity, 99% coverage: 3:247/248 of query aligns to 5:258/259 of 8hfkA
- binding 2-bromanyl-1-(4-bromanyl-2-oxidanyl-phenyl)ethanone: S143 (= S141), N144 (≠ V142), T145 (≠ V143), F153 (≠ S151), Y156 (= Y154), G187 (= G185), M193 (≠ G191), V197 (≠ A195)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G13), R18 (≠ K16), I20 (= I18), A40 (= A38), N41 (≠ S39), S42 (= S40), D66 (= D64), N93 (= N91), S94 (= S92), L116 (≠ V114), T141 (≠ V139), Y156 (= Y154), K160 (= K158), P186 (= P184), G187 (= G185), G188 (≠ M186), T189 (≠ V187), T191 (= T189), M193 (≠ G191)
Sites not aligning to the query:
4fj1B Crystal structure of the ternary complex between a fungal 17beta- hydroxysteroid dehydrogenase (holo form) and genistein (see paper)
40% identity, 99% coverage: 3:247/248 of query aligns to 4:258/259 of 4fj1B
- active site: G18 (= G17), S142 (= S141), N143 (≠ V142), H153 (≠ S151), Y156 (= Y154), K160 (= K158), Y201 (vs. gap)
- binding genistein: G188 (≠ M186), F194 (≠ T192), S198 (vs. gap), Y201 (vs. gap), I202 (vs. gap), M216 (≠ W205), A217 (= A206)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G14 (= G13), R17 (≠ K16), G18 (= G17), I19 (= I18), A39 (= A38), N40 (≠ S39), S41 (= S40), I66 (≠ V65), N92 (= N91), S93 (= S92), G94 (= G93), L115 (≠ V114), T140 (≠ V139), S142 (= S141), Y156 (= Y154), K160 (= K158), G187 (= G185), T189 (≠ V187), T191 (= T189), M193 (≠ G191)
4fj2B Crystal structure of the ternary complex between a fungal 17beta- hydroxysteroid dehydrogenase (holo form) and biochanin a (see paper)
40% identity, 99% coverage: 3:247/248 of query aligns to 5:259/260 of 4fj2B
- active site: G19 (= G17), S143 (= S141), N144 (≠ V142), H154 (≠ S151), Y157 (= Y154), K161 (= K158), Y202 (vs. gap)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G13), R18 (≠ K16), G19 (= G17), I20 (= I18), A40 (= A38), N41 (≠ S39), S42 (= S40), I67 (≠ V65), N93 (= N91), S94 (= S92), G95 (= G93), L116 (≠ V114), T141 (≠ V139), Y157 (= Y154), K161 (= K158), G188 (= G185), G189 (≠ M186), T190 (≠ V187), T192 (= T189), M194 (≠ G191)
- binding 5,7-dihydroxy-3-(4-methoxyphenyl)-4H-chromen-4-one: G189 (≠ M186), F195 (≠ T192), V198 (vs. gap), S199 (vs. gap), Y202 (vs. gap), I203 (vs. gap), M217 (≠ W205), A218 (= A206)
3qwiA Crystal structure of a 17beta-hydroxysteroid dehydrogenase (holo form) from fungus cochliobolus lunatus in complex with NADPH and coumestrol (see paper)
40% identity, 99% coverage: 3:247/248 of query aligns to 5:259/260 of 3qwiA
- active site: G19 (= G17), S143 (= S141), N144 (≠ V142), H154 (≠ S151), Y157 (= Y154), K161 (= K158), Y202 (vs. gap)
- binding Coumestrol: F149 (≠ I146), G189 (≠ M186), M194 (≠ G191), Y202 (vs. gap), I203 (vs. gap), A218 (= A206)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G13), R18 (≠ K16), I20 (= I18), A40 (= A38), N41 (≠ S39), S42 (= S40), I67 (≠ V65), N93 (= N91), S94 (= S92), G95 (= G93), L116 (≠ V114), T141 (≠ V139), Y157 (= Y154), K161 (= K158), P187 (= P184), G188 (= G185), G189 (≠ M186), T190 (≠ V187), T192 (= T189), M194 (≠ G191)
3qwhA Crystal structure of the 17beta-hydroxysteroid dehydrogenase from cochliobolus lunatus in complex with NADPH and kaempferol (see paper)
40% identity, 99% coverage: 3:247/248 of query aligns to 5:259/260 of 3qwhA
- active site: G19 (= G17), S143 (= S141), N144 (≠ V142), H154 (≠ S151), Y157 (= Y154), K161 (= K158), Y202 (vs. gap)
- binding 3,5,7-trihydroxy-2-(4-hydroxyphenyl)-4h-chromen-4-one: N144 (≠ V142), F149 (≠ I146), G189 (≠ M186), F195 (≠ T192), S199 (vs. gap), Y202 (vs. gap), I203 (vs. gap), A218 (= A206)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G13), R18 (≠ K16), G19 (= G17), I20 (= I18), A40 (= A38), N41 (≠ S39), S42 (= S40), D66 (= D64), I67 (≠ V65), N93 (= N91), S94 (= S92), G95 (= G93), L116 (≠ V114), T141 (≠ V139), Y157 (= Y154), K161 (= K158), P187 (= P184), G188 (= G185), G189 (≠ M186), T190 (≠ V187), T192 (= T189), M194 (≠ G191)
4fj0D Crystal structure of the ternary complex between a fungal 17beta- hydroxysteroid dehydrogenase (holo form) and 3,7-dihydroxy flavone (see paper)
40% identity, 99% coverage: 3:247/248 of query aligns to 6:260/261 of 4fj0D
- active site: G20 (= G17), S144 (= S141), N145 (≠ V142), H155 (≠ S151), Y158 (= Y154), K162 (= K158), Y203 (vs. gap)
- binding 3,7-dihydroxy-2-phenyl-4H-chromen-4-one: S144 (= S141), N145 (≠ V142), G190 (≠ M186), F196 (≠ T192), S200 (vs. gap), Y203 (vs. gap), A219 (= A206)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G16 (= G13), R19 (≠ K16), G20 (= G17), I21 (= I18), A41 (= A38), N42 (≠ S39), S43 (= S40), I68 (≠ V65), N94 (= N91), S95 (= S92), G96 (= G93), L117 (≠ V114), T142 (≠ V139), Y158 (= Y154), K162 (= K158), P188 (= P184), G189 (= G185), G190 (≠ M186), T191 (≠ V187), T193 (= T189), M195 (≠ G191)
7yb2D Crystal structure of anthrol reductase (cbar) in complex with NADP+ and emodin (see paper)
40% identity, 99% coverage: 3:247/248 of query aligns to 9:263/264 of 7yb2D
- binding 3-methyl-1,6,8-trihydroxyanthraquinone: S147 (= S141), Y161 (= Y154), G193 (≠ M186), M198 (≠ G191), F199 (≠ T192), V202 (≠ A195), S203 (≠ G196), Y206 (vs. gap)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G19 (= G13), R22 (≠ K16), G23 (= G17), I24 (= I18), Y43 (= Y37), A44 (= A38), N45 (≠ S39), S46 (= S40), D70 (= D64), V71 (= V65), N97 (= N91), S98 (= S92), L120 (≠ V114), T145 (≠ V139), S147 (= S141), Y161 (= Y154), K165 (= K158), P191 (= P184), G192 (= G185), T194 (≠ V187), T196 (= T189), M198 (≠ G191)
8hfjC Crystal structure of cbar mutant (h162f) in complex with NADP+ and a bulky 1,3-cyclodiketone (see paper)
40% identity, 99% coverage: 3:247/248 of query aligns to 5:259/260 of 8hfjC
- binding 2-methyl-2-[(4-methylphenyl)methyl]cyclopentane-1,3-dione: N144 (≠ V142), T145 (≠ V143), F154 (≠ S151), G189 (≠ M186), V198 (≠ A195)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G13), R18 (≠ K16), I20 (= I18), Y39 (= Y37), A40 (= A38), N41 (≠ S39), S42 (= S40), D66 (= D64), V67 (= V65), N93 (= N91), S94 (= S92), L116 (≠ V114), T141 (≠ V139), Y157 (= Y154), K161 (= K158), P187 (= P184), T190 (≠ V187), T192 (= T189), M194 (≠ G191)
Sites not aligning to the query:
6ypzAAA Monooxygenase (see paper)
41% identity, 99% coverage: 2:247/248 of query aligns to 1:251/253 of 6ypzAAA
- active site: G16 (= G17), S148 (= S141), Y161 (= Y154)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G12 (= G13), S14 (= S15), R15 (≠ K16), G16 (= G17), I17 (= I18), H35 (≠ N36), A37 (= A38), S38 (= S39), N39 (≠ S40), L64 (≠ V65), N96 (= N91), A97 (≠ S92), A98 (≠ G93), T100 (≠ Y95), I146 (≠ V139), S147 (= S140), S148 (= S141), Y161 (= Y154), K165 (= K158), P191 (= P184), G192 (= G185), I193 (≠ M186), T194 (≠ V187), N196 (≠ T189)
6yq0AAA Monooxygenase (see paper)
41% identity, 99% coverage: 2:247/248 of query aligns to 1:251/254 of 6yq0AAA
- active site: G16 (= G17), S148 (= S141), Y161 (= Y154)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G13), S14 (= S15), R15 (≠ K16), G16 (= G17), I17 (= I18), H35 (≠ N36), A37 (= A38), S38 (= S39), N39 (≠ S40), L64 (≠ V65), N96 (= N91), A97 (≠ S92), A98 (≠ G93), T100 (≠ Y95), R117 (≠ K110), I146 (≠ V139), S147 (= S140), S148 (= S141), Y161 (= Y154), K165 (= K158), P191 (= P184), G192 (= G185), I193 (≠ M186), T194 (≠ V187), N196 (≠ T189)
- binding (3~{R})-8-methoxy-3-methyl-3-oxidanyl-2,4-dihydrobenzo[a]anthracene-1,7,12-trione: T100 (≠ Y95), G101 (= G96), S148 (= S141), G149 (≠ V142), L150 (≠ V143), C153 (≠ I146), Q158 (≠ S151), Y161 (= Y154), G192 (= G185), I193 (≠ M186), T251 (≠ S247)
5wuwA Serratia marcescens short-chain dehydrogenase/reductase f98l/f202l mutant (see paper)
42% identity, 98% coverage: 4:246/248 of query aligns to 3:242/245 of 5wuwA
- active site: G16 (= G17), S140 (= S141), Y154 (= Y154), L161 (≠ V161)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G13), R15 (≠ K16), I17 (= I18), Y36 (= Y37), A37 (= A38), A38 (≠ S39), D63 (= D64), S64 (≠ V65), N90 (= N91), A91 (≠ S92), G92 (= G93), Y154 (= Y154), K158 (= K158), G185 (= G185), P186 (≠ M186), V187 (= V187)
6yq3AAA Monooxygenase (see paper)
41% identity, 99% coverage: 2:247/248 of query aligns to 1:249/252 of 6yq3AAA
- active site: G16 (= G17), S146 (= S141), Y159 (= Y154)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G13), S14 (= S15), R15 (≠ K16), G16 (= G17), I17 (= I18), H35 (≠ N36), A37 (= A38), S38 (= S39), N39 (≠ S40), L64 (≠ V65), N96 (= N91), A97 (≠ S92), A98 (≠ G93), V119 (= V114), I144 (≠ V139), Y159 (= Y154), K163 (= K158), P189 (= P184), G190 (= G185), I191 (≠ M186), T192 (≠ V187), N194 (≠ T189)
- binding (3~{R})-8-methoxy-3-methyl-3,6-bis(oxidanyl)-2,4-dihydrobenzo[a]anthracene-1,7,12-trione: S146 (= S141), G147 (≠ V142), L148 (≠ V143), Q156 (≠ S151), Y159 (= Y154), I191 (≠ M186), T249 (≠ S247)
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
39% identity, 97% coverage: 7:246/248 of query aligns to 5:243/246 of 3osuA
3iccA Crystal structure of a putative 3-oxoacyl-(acyl carrier protein) reductase from bacillus anthracis at 1.87 a resolution (see paper)
38% identity, 99% coverage: 2:247/248 of query aligns to 3:253/255 of 3iccA
- active site: G18 (= G17), S148 (= S141), F158 (≠ S151), Y161 (= Y154), K165 (= K158)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G14 (= G13), S16 (= S15), R17 (≠ K16), G18 (= G17), I19 (= I18), H37 (≠ N36), Y38 (= Y37), G39 (≠ A38), L66 (≠ V65), E67 (≠ S66), N98 (= N91), G100 (= G93), I146 (≠ V139), S148 (= S141), Y161 (= Y154), K165 (= K158), P191 (= P184), G192 (= G185), M198 (≠ G191), N199 (≠ T192)
1edoA The x-ray structure of beta-keto acyl carrier protein reductase from brassica napus complexed with NADP+ (see paper)
40% identity, 96% coverage: 8:246/248 of query aligns to 3:241/244 of 1edoA
- active site: G12 (= G17), S138 (= S141), Y151 (= Y154), K155 (= K158)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G13), S10 (= S15), R11 (≠ K16), I13 (= I18), N31 (= N36), Y32 (= Y37), A33 (= A38), R34 (≠ S39), S35 (= S40), D59 (= D64), V60 (= V65), N86 (= N91), A87 (≠ S92), S138 (= S141), Y151 (= Y154), K155 (= K158), P181 (= P184), G182 (= G185), I184 (≠ V187), S186 (≠ T189), M188 (≠ G191)
1g0nA Structure of trihydroxynaphthalene reductase in complex with NADPH and 4,5,6,7-tetrachloro-phthalide (see paper)
39% identity, 98% coverage: 4:247/248 of query aligns to 17:271/273 of 1g0nA
- active site: G30 (= G17), S154 (= S141), H165 (≠ S151), Y168 (= Y154), K172 (= K158)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G26 (= G13), R29 (≠ K16), G30 (= G17), I31 (= I18), A51 (= A38), N52 (≠ S39), S53 (= S40), V78 (= V65), N104 (= N91), S105 (= S92), G106 (= G93), I127 (≠ V114), M152 (≠ V139), Y168 (= Y154), K172 (= K158), P198 (= P184), G200 (≠ M186), I201 (≠ V187), T203 (= T189), M205 (≠ G191)
- binding 4,5,6,7-tetrachloro-phthalide: S154 (= S141), Y168 (= Y154), G200 (≠ M186), M205 (≠ G191), Y206 (≠ T192), C210 (≠ G196), Y213 (≠ F197), W233 (≠ T209)
1dohA Structure of trihydroxynaphthalene reductase in complex with NADPH and 4-nitro-inden-1-one (see paper)
39% identity, 98% coverage: 4:247/248 of query aligns to 17:271/273 of 1dohA
- active site: G30 (= G17), S154 (= S141), H165 (≠ S151), Y168 (= Y154), K172 (= K158), Y213 (≠ F197)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G26 (= G13), R29 (≠ K16), G30 (= G17), I31 (= I18), A51 (= A38), N52 (≠ S39), S53 (= S40), N77 (≠ D64), V78 (= V65), N104 (= N91), S105 (= S92), G106 (= G93), M152 (≠ V139), Y168 (= Y154), K172 (= K158), P198 (= P184), G200 (≠ M186), I201 (≠ V187), T203 (= T189), M205 (≠ G191)
- binding 4-nitro-inden-1-one: Y168 (= Y154), G200 (≠ M186), Y206 (≠ T192), C210 (≠ G196), Y213 (≠ F197)
1g0oC Structure of trihydroxynaphthalene reductase in complex with NADPH and pyroquilon (see paper)
39% identity, 98% coverage: 4:247/248 of query aligns to 25:279/281 of 1g0oC
- active site: G38 (= G17), S162 (= S141), H173 (≠ S151), Y176 (= Y154), K180 (= K158), Y221 (≠ F197)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G34 (= G13), R37 (≠ K16), G38 (= G17), I39 (= I18), A59 (= A38), N60 (≠ S39), S61 (= S40), N85 (≠ D64), V86 (= V65), N112 (= N91), S113 (= S92), G114 (= G93), M160 (≠ V139), Y176 (= Y154), K180 (= K158), P206 (= P184), G208 (≠ M186), I209 (≠ V187), T211 (= T189), M213 (≠ G191)
- binding pyroquilon: S162 (= S141), I163 (≠ V142), Y176 (= Y154), G208 (≠ M186), Y221 (≠ F197)
1ybvA Structure of trihydroxynaphthalene reductase in complex with NADPH and an active site inhibitor (see paper)
39% identity, 98% coverage: 4:247/248 of query aligns to 14:268/270 of 1ybvA
- active site: G27 (= G17), S151 (= S141), H162 (≠ S151), Y165 (= Y154), K169 (= K158), Y210 (≠ F197)
- binding 5-methyl-1,2,4-triazolo[3,4-b]benzothiazole: S151 (= S141), Y165 (= Y154), G197 (≠ M186), M202 (≠ G191), Y203 (≠ T192), Y210 (≠ F197), W230 (≠ T209)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G23 (= G13), R26 (≠ K16), G27 (= G17), I28 (= I18), A48 (= A38), N49 (≠ S39), S50 (= S40), N74 (≠ D64), V75 (= V65), N101 (= N91), S102 (= S92), G103 (= G93), M149 (≠ V139), S151 (= S141), K169 (= K158), P195 (= P184), G197 (≠ M186), I198 (≠ V187), T200 (= T189), M202 (≠ G191)
Query Sequence
>H281DRAFT_01131 FitnessBrowser__Burk376:H281DRAFT_01131
MSKLAGKVAVVTGASKGIGAAIAKSLAAHGASVVVNYASSKAGADDVVAAITAAGGKAVA
VAGDVSKAADAKGIVDAAVEKYGRLDILVNNSGVYGFSTIEEITEEHFHKHFNVNVLGLL
LVTQAAVKHLGEGGSIVNVSSVVSRITPPGSAVYTATKGAVDGITGVLAKELGPRKIRVN
SVNPGMVATEGTHSAGFIGSDLETWAVSTTPLGRIGQPDDIAEVVAFLASDEARWLTGES
LIASGGSR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory