SitesBLAST
Comparing H281DRAFT_01140 FitnessBrowser__Burk376:H281DRAFT_01140 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7dqxE Crystal structure of xanthine dehydrogenase family protein
35% identity, 100% coverage: 1:272/273 of query aligns to 1:283/293 of 7dqxE
- binding flavin-adenine dinucleotide: K29 (≠ R29), I30 (≠ V30), I31 (≠ L31), G33 (= G33), G34 (= G34), Q35 (= Q35), S36 (= S36), L37 (= L37), H78 (≠ Q80), I101 (= I103), A102 (≠ S104), I106 (= I108), G110 (= G112), T111 (= T113), G113 (≠ C115), G114 (= G116), S115 (= S117), A117 (= A119), A123 (= A125), E124 (= E126), I167 (≠ V169), Y193 (≠ F195)
1ffuC Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor (see paper)
34% identity, 79% coverage: 1:217/273 of query aligns to 1:220/287 of 1ffuC
- binding flavin-adenine dinucleotide: K29 (≠ R29), L30 (≠ V30), A32 (= A32), G33 (= G33), G34 (= G34), H35 (≠ Q35), S36 (= S36), L37 (= L37), I54 (= I54), I101 (= I103), A102 (≠ S104), G110 (= G112), T111 (= T113), G114 (= G116), D115 (≠ S117), A117 (= A119), N123 (≠ A125), D124 (≠ E126), L161 (≠ R163), V166 (≠ L168), M167 (≠ V169), W193 (≠ F195)
1t3qC Crystal structure of quinoline 2-oxidoreductase from pseudomonas putida 86 (see paper)
33% identity, 100% coverage: 1:272/273 of query aligns to 1:279/285 of 1t3qC
- binding flavin-adenine dinucleotide: I29 (≠ V30), A31 (= A32), G32 (= G33), G33 (= G34), Q34 (= Q35), S35 (= S36), L36 (= L37), V100 (≠ I103), A101 (≠ S104), V105 (≠ I108), T110 (= T113), G113 (= G116), S114 (= S117), A116 (= A119), A122 (= A125), E123 (= E126), L166 (≠ V169), Y190 (≠ F195)
4zohB Crystal structure of glyceraldehyde oxidoreductase (see paper)
33% identity, 99% coverage: 1:269/273 of query aligns to 1:269/274 of 4zohB
- active site: Y256 (= Y256)
- binding flavin-adenine dinucleotide: R28 (= R29), P29 (≠ V30), A31 (= A32), G32 (= G33), G33 (= G34), H34 (≠ Q35), S35 (= S36), L36 (= L37), H77 (≠ Q80), I95 (= I103), G96 (≠ S104), V100 (≠ I108), T105 (= T113), G108 (= G116), S109 (= S117), S111 (≠ A119), A117 (= A125), D118 (≠ E126), L160 (= L168), V161 (= V169), D185 (= D194), F186 (= F195)
1n5wC Crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form (see paper)
32% identity, 88% coverage: 1:239/273 of query aligns to 1:239/287 of 1n5wC
P19920 Carbon monoxide dehydrogenase medium chain; CO dehydrogenase subunit M; CO-DH M; EC 1.2.5.3 from Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5) (Oligotropha carboxidovorans) (see 2 papers)
32% identity, 88% coverage: 1:239/273 of query aligns to 1:239/288 of P19920
Q0QLF4 Nicotinate dehydrogenase FAD-subunit; NDH; Nicotinic acid hydroxylase FAD-subunit; NAH; EC 1.17.1.5 from Eubacterium barkeri (Clostridium barkeri) (see paper)
27% identity, 61% coverage: 6:172/273 of query aligns to 4:172/296 of Q0QLF4
- 29:36 (vs. 30:37, 50% identical) binding
- G101 (≠ S104) binding
- TIGGN 110:114 (≠ TVCGS 113:117) binding
- D123 (≠ E126) binding
- R160 (= R163) binding
- M169 (≠ V169) binding
Sites not aligning to the query:
3hrdG Crystal structure of nicotinate dehydrogenase (see paper)
27% identity, 61% coverage: 6:172/273 of query aligns to 4:172/292 of 3hrdG
- binding flavin-adenine dinucleotide: I29 (≠ V30), A31 (= A32), G32 (= G33), G33 (= G34), T34 (≠ Q35), D35 (≠ S36), F77 (≠ Q80), V100 (≠ I103), G101 (≠ S104), I105 (= I108), T110 (= T113), G113 (= G116), N114 (≠ S117), S116 (≠ A119), T117 (≠ H120), G122 (≠ A125), D123 (≠ E126), I168 (≠ L168), M169 (≠ V169)
P47989 Xanthine dehydrogenase/oxidase; EC 1.17.1.4; EC 1.17.3.2 from Homo sapiens (Human) (see 4 papers)
27% identity, 78% coverage: 8:221/273 of query aligns to 236:464/1333 of P47989
- 257:264 (vs. 30:37, 13% identical) binding
- F337 (= F106) binding
- SVGGN 347:351 (≠ TVCGS 113:117) binding
- D360 (≠ E126) binding
- K395 (≠ M160) to M: in dbSNP:rs34929837
- K422 (≠ A186) binding
Sites not aligning to the query:
- 133 E → K: in dbSNP:rs45447191
- 172 G → R: in dbSNP:rs45523133
- 235 T → M: in dbSNP:rs45469499
- 509 modified: Disulfide link with 1318, In oxidase form
- 536 modified: Disulfide link with 993, In oxidase form
- 555 P → S: in dbSNP:rs45577338
- 584 D → A: in dbSNP:rs45491693
- 607 R → Q: in dbSNP:rs45442092
- 617 K → N: in dbSNP:rs45442398
- 623 T → I: in dbSNP:rs45448694
- 646 I → V: in dbSNP:rs17323225
- 703 I → V: in dbSNP:rs17011368
- 763 L → F: in a breast cancer sample; somatic mutation
- 791 R → G: in a breast cancer sample; somatic mutation; dbSNP:rs775646772
- 910 T → M: in dbSNP:rs669884
- 993 modified: Disulfide link with 536, In oxidase form
- 1091 V → L: in dbSNP:rs45619033
- 1109 N → T: in dbSNP:rs45547640
- 1150 P → R: in dbSNP:rs1042036
- 1176 R → C: in dbSNP:rs45624433
- 1296 R → W: in dbSNP:rs45564939
- 1318 modified: Disulfide link with 509, In oxidase form
2e1qA Crystal structure of human xanthine oxidoreductase mutant, glu803val (see paper)
27% identity, 78% coverage: 8:221/273 of query aligns to 210:438/1307 of 2e1qA
- binding flavin-adenine dinucleotide: K230 (≠ R29), L231 (≠ V30), V232 (≠ L31), V233 (≠ A32), G234 (= G33), N235 (≠ G34), T236 (≠ Q35), E237 (≠ S36), I238 (≠ L37), F311 (= F106), A312 (vs. gap), V316 (≠ I108), A320 (≠ G112), S321 (≠ T113), G324 (= G116), N325 (≠ S117), I327 (≠ A119), T328 (≠ H120), S333 (≠ A125), D334 (≠ E126), I377 (≠ L168), L378 (≠ V169)
Sites not aligning to the query:
- active site: 742, 777, 855, 859, 887, 1235, 1236
- binding bicarbonate ion: 814, 815, 852, 886, 889, 890, 893
- binding calcium ion: 715, 716, 718, 741, 747, 780, 781, 784, 811, 812
- binding flavin-adenine dinucleotide: 43, 44
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 71, 110, 111, 112, 114, 146, 148, 719
- binding hydroxy(dioxo)molybdenum: 773, 774, 887, 1053, 1054, 1236
6a7xB Rat xanthine oxidoreductase, d428a variant, NAD bound form
24% identity, 78% coverage: 8:221/273 of query aligns to 206:434/1291 of 6a7xB
- binding flavin-adenine dinucleotide: L227 (≠ V30), V228 (≠ L31), V229 (≠ A32), G230 (= G33), N231 (≠ G34), T232 (≠ Q35), E233 (≠ S36), I234 (≠ L37), F307 (vs. gap), V312 (≠ I108), S317 (≠ T113), G320 (= G116), N321 (≠ S117), I323 (≠ A119), T324 (≠ H120), D330 (≠ E126), I373 (≠ L168), L374 (≠ V169)
- binding nicotinamide-adenine-dinucleotide: P327 (= P123), Y363 (≠ M158), R364 (≠ L159), G428 (= G215), A430 (= A217), D431 (= D218)
Sites not aligning to the query:
- active site: 738, 773, 851, 855, 883, 1231, 1232
- binding bicarbonate ion: 810, 811, 880, 881, 885, 886, 889
- binding flavin-adenine dinucleotide: 44
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 69, 71, 109, 110, 111, 113, 145, 147, 715
- binding nicotinamide-adenine-dinucleotide: 471, 478
- binding uric acid: 773, 851, 885, 980, 981, 1049, 1050, 1232
6a7xA Rat xanthine oxidoreductase, d428a variant, NAD bound form
24% identity, 78% coverage: 8:221/273 of query aligns to 208:436/1295 of 6a7xA
- binding flavin-adenine dinucleotide: K228 (≠ R29), L229 (≠ V30), V230 (≠ L31), V231 (≠ A32), G232 (= G33), N233 (≠ G34), T234 (≠ Q35), E235 (≠ S36), I236 (≠ L37), F309 (vs. gap), V314 (≠ I108), S319 (≠ T113), G322 (= G116), N323 (≠ S117), I325 (≠ A119), T326 (≠ H120), D332 (≠ E126), L376 (≠ V169)
- binding nicotinamide-adenine-dinucleotide: P329 (= P123), Y365 (≠ M158), R366 (≠ L159), A432 (= A217), D433 (= D218)
Sites not aligning to the query:
- active site: 740, 775, 853, 857, 885, 1233, 1234
- binding bicarbonate ion: 812, 813, 850, 883, 884, 887, 888, 891
- binding flavin-adenine dinucleotide: 44
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 69, 71, 109, 110, 111, 113, 145, 147
- binding nicotinamide-adenine-dinucleotide: 473, 480
- binding uric acid: 775, 853, 887, 982, 983, 1052, 1234
P22985 Xanthine dehydrogenase/oxidase; EC 1.17.1.4; EC 1.17.3.2 from Rattus norvegicus (Rat) (see 2 papers)
24% identity, 78% coverage: 8:221/273 of query aligns to 235:463/1331 of P22985
- 256:263 (vs. 30:37, 13% identical) binding
- WF 335:336 (vs. gap) mutation to AL: Converts the enzyme to the oxidase form that utilizes molecular oxygen as electron acceptor. Interferes with normal conversion to the dehydrogenase form by reducing agents.
- SIGGN 346:350 (≠ TVCGS 113:117) binding
- D359 (≠ E126) binding
- L403 (≠ V169) binding
Sites not aligning to the query:
- 43 binding
- 48 binding
- 51 binding
- 73 binding
- 112 binding
- 115 binding
- 147 binding
- 149 binding
- 535 C→A: Slows the conversion from the dehydrogenase form to the oxidase form; when associated with R-992. Abolishes conversion from the dehydrogenase form to the oxidase form; when associated with R-992 and S-1316.
- 992 C→R: Slows the conversion from the dehydrogenase form to the oxidase form; when associated with A-535. Abolishes conversion from the dehydrogenase form to the oxidase form; when associated with A-535 and S-1316.
- 1316 C→S: Abolishes conversion from the dehydrogenase form to the oxidase form; when associated with A-535 and R-992.
4yswA Structure of rat xanthine oxidoreductase, c-terminal deletion protein variant, nadh bound form (see paper)
24% identity, 78% coverage: 8:221/273 of query aligns to 206:434/1286 of 4yswA
- binding flavin-adenine dinucleotide: K226 (≠ R29), L227 (≠ V30), V228 (≠ L31), V229 (≠ A32), G230 (= G33), N231 (≠ G34), T232 (≠ Q35), E233 (≠ S36), I234 (≠ L37), F307 (vs. gap), A308 (≠ S104), V312 (≠ I108), A316 (≠ G112), S317 (≠ T113), G320 (= G116), N321 (≠ S117), I323 (≠ A119), T324 (≠ H120), S329 (≠ A125), D330 (≠ E126), I373 (≠ L168), L374 (≠ V169), D399 (≠ G193)
- binding 1,4-dihydronicotinamide adenine dinucleotide: E233 (≠ S36), S326 (≠ D122), P327 (= P123), I328 (≠ S124), Y363 (≠ M158), R364 (≠ L159), D400 (= D194), I401 (≠ F195), G428 (= G215), A430 (= A217), D431 (= D218)
Sites not aligning to the query:
- active site: 738, 773, 851, 855, 883, 1231, 1232
- binding bicarbonate ion: 810, 811, 848, 880, 881, 882, 885, 886, 889
- binding calcium ion: 838, 841, 842, 845, 878, 879
- binding flavin-adenine dinucleotide: 44
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 71, 110, 111, 113, 145, 147, 715
- binding 1,4-dihydronicotinamide adenine dinucleotide: 471, 478, 1196
- binding uric acid: 773, 851, 885, 980, 981, 1050, 1232
2e3tA Crystal structure of rat xanthine oxidoreductase mutant (w335a and f336l) (see paper)
24% identity, 78% coverage: 8:221/273 of query aligns to 208:436/1291 of 2e3tA
- binding flavin-adenine dinucleotide: K228 (≠ R29), L229 (≠ V30), V230 (≠ L31), V231 (≠ A32), G232 (= G33), N233 (≠ G34), T234 (≠ Q35), E235 (≠ S36), I236 (≠ L37), L309 (vs. gap), A318 (≠ G112), S319 (≠ T113), G322 (= G116), N323 (≠ S117), I325 (≠ A119), T326 (≠ H120), S331 (≠ A125), D332 (≠ E126), I375 (≠ L168), L376 (≠ V169)
Sites not aligning to the query:
- active site: 740, 775, 853, 857, 885, 1233, 1234
- binding bicarbonate ion: 812, 813, 850, 882, 883, 887, 888, 891
- binding calcium ion: 713, 714, 716, 809, 810, 840, 843, 844, 847, 880, 881
- binding flavin-adenine dinucleotide: 44
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 69, 71, 109, 110, 113, 145, 147, 717
- binding uric acid: 775, 853, 887, 982, 983, 1051, 1052, 1234
3ax7A Bovine xanthine oxidase, protease cleaved form (see paper)
25% identity, 78% coverage: 8:221/273 of query aligns to 177:405/1225 of 3ax7A
- binding flavin-adenine dinucleotide: K197 (≠ R29), L198 (≠ V30), V199 (≠ L31), V200 (≠ A32), G201 (= G33), N202 (≠ G34), T203 (≠ Q35), E204 (≠ S36), I205 (≠ L37), F278 (= F106), A279 (vs. gap), V283 (≠ I108), A287 (≠ G112), S288 (≠ T113), G291 (= G116), N292 (≠ S117), I294 (≠ A119), T295 (≠ H120), S300 (≠ A125), D301 (≠ E126), L345 (≠ V169)
Sites not aligning to the query:
- active site: 666, 701, 779, 783, 811, 1159, 1160
- binding bicarbonate ion: 738, 739, 776, 808, 809, 814, 817
- binding calcium ion: 766, 769, 770, 773, 806, 807
- binding flavin-adenine dinucleotide: 45
- binding fe2/s2 (inorganic) cluster: 41, 42, 43, 45, 47, 48, 50, 70, 72, 112, 113, 115, 147, 149, 643
- binding {[(5aR,8R,9aR)-2-amino-4-oxo-6,7-di(sulfanyl-kappaS)-3,5,5a,8,9a,10-hexahydro-4H-pyrano[3,2-g]pteridin-8-yl]methyl dihydrogenato(2-) phosphate}(hydroxy)oxo(thioxo)molybdenum: 111, 149, 695, 696, 697, 698, 810, 811, 937, 938, 939, 977, 978, 979, 981, 1093, 1160
P80457 Xanthine dehydrogenase/oxidase; EC 1.17.1.4; EC 1.17.3.2 from Bos taurus (Bovine) (see 5 papers)
25% identity, 78% coverage: 8:221/273 of query aligns to 236:464/1332 of P80457
- 257:264 (vs. 30:37, 13% identical) binding
- R335 (≠ S104) mutation to A: Promotes conversion to the oxidase form that utilizes molecular oxygen as electron acceptor. Interferes with normal conversion to the dehydrogenase form by reducing agents.
- W336 (≠ H105) mutation to A: Promotes conversion to the oxidase form that utilizes molecular oxygen as electron acceptor. Interferes with normal conversion to the dehydrogenase form by reducing agents.
- F337 (= F106) binding
- SLGGN 347:351 (≠ TVCGS 113:117) binding
- D360 (≠ E126) binding
- L404 (≠ V169) binding
- K422 (≠ A186) binding
- R427 (= R191) mutation to Q: Promotes conversion to the oxidase form that utilizes molecular oxygen as electron acceptor. Interferes with normal conversion to the dehydrogenase form by reducing agents.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 43 binding
- 48 binding
- 51 binding
- 73 binding
- 113 binding
- 116 binding
- 148 binding
- 150 binding
- 767 binding
- 798 binding
- 912 binding
- 1079 binding
- 1261 active site, Proton acceptor
3unaA Crystal structure of bovine milk xanthine dehydrogenase with NAD bound (see paper)
25% identity, 78% coverage: 8:221/273 of query aligns to 206:434/1286 of 3unaA
- binding flavin-adenine dinucleotide: L227 (≠ V30), V228 (≠ L31), V229 (≠ A32), G230 (= G33), N231 (≠ G34), T232 (≠ Q35), E233 (≠ S36), I234 (≠ L37), F307 (= F106), A308 (vs. gap), A316 (≠ G112), S317 (≠ T113), G320 (= G116), N321 (≠ S117), I323 (≠ A119), T324 (≠ H120), S329 (≠ A125), D330 (≠ E126), I373 (≠ L168), L374 (≠ V169)
- binding nicotinamide-adenine-dinucleotide: P327 (= P123), Y363 (≠ M158), R364 (≠ L159), A430 (= A217), D431 (= D218)
Sites not aligning to the query:
- active site: 729, 764, 842, 846, 874, 1222, 1223
- binding calcium ion: 829, 832, 833, 836, 869, 870
- binding carbonate ion: 801, 802, 871, 872, 876, 877, 880
- binding flavin-adenine dinucleotide: 43, 44
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 69, 71, 110, 111, 112, 114, 146, 148, 706
- binding nicotinamide-adenine-dinucleotide: 471, 478
1n5xA Xanthine dehydrogenase from bovine milk with inhibitor tei-6720 bound (see paper)
25% identity, 78% coverage: 8:221/273 of query aligns to 208:436/1290 of 1n5xA
- binding flavin-adenine dinucleotide: L229 (≠ V30), V231 (≠ A32), G232 (= G33), N233 (≠ G34), T234 (≠ Q35), E235 (≠ S36), I236 (≠ L37), F309 (= F106), A310 (vs. gap), A318 (≠ G112), S319 (≠ T113), G322 (= G116), N323 (≠ S117), I325 (≠ A119), T326 (≠ H120), D332 (≠ E126), L376 (≠ V169)
Sites not aligning to the query:
- active site: 734, 769, 847, 851, 879, 1227, 1228
- binding flavin-adenine dinucleotide: 43, 44
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 71, 110, 111, 112, 114, 146, 148, 711
- binding 2-(3-cyano-4-isobutoxy-phenyl)-4-methyl-5-thiazole-carboxylic acid: 615, 738, 769, 840, 847, 881, 976, 977, 978, 981
3bdjA Crystal structure of bovine milk xanthine dehydrogenase with a covalently bound oxipurinol inhibitor (see paper)
25% identity, 78% coverage: 8:221/273 of query aligns to 206:434/1286 of 3bdjA
- binding flavin-adenine dinucleotide: L227 (≠ V30), V228 (≠ L31), V229 (≠ A32), G230 (= G33), N231 (≠ G34), T232 (≠ Q35), E233 (≠ S36), I234 (≠ L37), F307 (= F106), A308 (vs. gap), A316 (≠ G112), S317 (≠ T113), G320 (= G116), N321 (≠ S117), I323 (≠ A119), T324 (≠ H120), S329 (≠ A125), D330 (≠ E126), I373 (≠ L168), L374 (≠ V169)
Sites not aligning to the query:
- active site: 729, 764, 842, 846, 874, 1222, 1223
- binding Oxypurinol: 764, 842, 876, 971, 972, 1040, 1041, 1223
- binding calcium ion: 829, 832, 833, 836, 869, 870
- binding carbonate ion: 801, 802, 871, 872, 876, 877, 880
- binding flavin-adenine dinucleotide: 43, 44
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 69, 71, 110, 111, 112, 114, 146, 148, 706
- binding Oxo(sulfanyl)molybdenum(IV) ION: 761, 872, 873, 874, 1223
Query Sequence
>H281DRAFT_01140 FitnessBrowser__Burk376:H281DRAFT_01140
MKPAPFDYLRAMNAQHALDALAQHGEDARVLAGGQSLMAVLNMRLAQPRMLIDISRTGEL
DSVRVDRKAGSLTVGAAATQGSVEWRASLRDEVPLLAMAFPHISHFQIRNRGTVCGSIAH
ADPSAELPLVLSALGGDVMLRSKKKPRVLSADAFFQGMLMTAREPDELVEAVRFPLKREG
ERYGFAEFSARHGDFAIVACAAVVTDDAIRLAVGGVADRPVVEQWPRLSGDDLRGALNDL
SWKLGAQDNAHISASYRRHLVRQLGWRVIEEAK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory