SitesBLAST
Comparing H281DRAFT_01141 FitnessBrowser__Burk376:H281DRAFT_01141 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1t3qB Crystal structure of quinoline 2-oxidoreductase from pseudomonas putida 86 (see paper)
33% identity, 75% coverage: 26:786/1020 of query aligns to 11:748/786 of 1t3qB
- active site: Q224 (≠ M236), A259 (≠ Q272), E336 (≠ T347), V343 (≠ C354), R371 (= R382), E743 (= E781), S744 (≠ G782)
- binding pterin cytosine dinucleotide: G254 (≠ S267), F255 (= F268), R371 (= R382), S506 (≠ A526), G507 (= G527), Q508 (= Q528), H510 (= H530), T513 (≠ V533), Y545 (= Y569), S547 (= S571), G549 (≠ F573), A550 (= A574), C666 (≠ A704), I670 (≠ L708), I674 (≠ L712), V675 (≠ A713), Q678 (= Q716), K739 (= K777), G740 (= G778), M741 (≠ L779), G742 (= G780)
1ffvB Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava (see paper)
32% identity, 76% coverage: 35:813/1020 of query aligns to 18:786/797 of 1ffvB
- active site: Q231 (≠ N234), V266 (≠ Q272), P343 (≠ Y349), I349 (≠ G353), R378 (vs. gap), C379 (vs. gap), E751 (= E781), S752 (≠ G782)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): G260 (= G266), G261 (≠ S267), F262 (= F268), G263 (= G269), A376 (≠ V381), R378 (vs. gap), C379 (vs. gap), Q516 (≠ A526), G517 (= G527), Q518 (= Q528), H520 (= H530), T523 (≠ V533), Y556 (= Y569), G557 (≠ S570), S558 (= S571), S560 (≠ F573), T561 (≠ A574), C674 (≠ A704), I678 (≠ L708), I683 (≠ A713), Q686 (= Q716), K747 (= K777), G748 (= G778), V749 (≠ L779), A750 (≠ G780), E751 (= E781)
1ffuB Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor (see paper)
32% identity, 76% coverage: 35:813/1020 of query aligns to 18:786/797 of 1ffuB
- active site: Q231 (≠ N234), V266 (≠ Q272), P343 (≠ Y349), I349 (≠ G353), R378 (vs. gap), C379 (vs. gap), E751 (= E781), S752 (≠ G782)
- binding cytidine-5'-diphosphate: Q518 (= Q528), H520 (= H530), T523 (≠ V533), S558 (= S571), S560 (≠ F573), T561 (≠ A574), C674 (≠ A704), T676 (= T706), I678 (≠ L708), I683 (≠ A713), K747 (= K777), G748 (= G778), V749 (≠ L779), A750 (≠ G780)
P19913 Carbon monoxide dehydrogenase large chain; CO dehydrogenase subunit L; CO-DH L; EC 1.2.5.3 from Hydrogenophaga pseudoflava (Pseudomonas carboxydoflava) (see paper)
32% identity, 76% coverage: 37:813/1020 of query aligns to 26:792/803 of P19913
- R384 (vs. gap) modified: 4-hydroxyarginine
7dqxD Crystal structure of xanthine dehydrogenase family protein
31% identity, 77% coverage: 26:815/1020 of query aligns to 3:764/770 of 7dqxD
- binding pterin cytosine dinucleotide: G247 (= G266), S248 (= S267), F249 (= F268), R363 (= R382), V491 (≠ A526), G492 (= G527), Q493 (= Q528), G494 (= G529), V498 (= V533), S530 (≠ N568), W531 (≠ Y569), S532 (= S570), S533 (= S571), R534 (= R572), S535 (≠ F573), T536 (≠ A574), T658 (≠ L712), T659 (≠ A713), Q662 (= Q716), G725 (= G778), L726 (= L779), G727 (= G780), E728 (= E781)
P19919 Carbon monoxide dehydrogenase large chain; CO dehydrogenase subunit L; CO-DH L; EC 1.2.5.3 from Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5) (Oligotropha carboxidovorans) (see 2 papers)
29% identity, 79% coverage: 7:807/1020 of query aligns to 3:792/809 of P19919
- C388 (vs. gap) binding
- E763 (= E781) binding
1n60B Crystal structure of the cu,mo-co dehydrogenase (codh); cyanide- inactivated form (see paper)
30% identity, 78% coverage: 14:807/1020 of query aligns to 4:786/803 of 1n60B
- active site: Q234 (≠ M236), V269 (≠ Q272), P346 (≠ Y349), I352 (≠ G353), R381 (vs. gap), C382 (vs. gap), E757 (= E781), S758 (≠ G782)
- binding pterin cytosine dinucleotide: G264 (≠ S267), F265 (= F268), R381 (vs. gap), Q522 (≠ A526), G523 (= G527), Q524 (= Q528), H526 (= H530), T529 (≠ V533), T561 (≠ N568), Y562 (= Y569), G563 (≠ S570), S564 (= S571), S566 (≠ F573), T567 (≠ A574), C680 (≠ A704), I684 (≠ L708), I688 (≠ L712), I689 (≠ A713), Q692 (= Q716), K753 (= K777), G754 (= G778), V755 (≠ L779), E757 (= E781)
- binding mo(vi)(=o)(oh)2 cluster: F265 (= F268), G266 (= G269), Y562 (= Y569), G563 (≠ S570), E757 (= E781)
1n62B Crystal structure of the mo,cu-co dehydrogenase (codh), n- butylisocyanide-bound state (see paper)
30% identity, 78% coverage: 14:807/1020 of query aligns to 5:787/804 of 1n62B
- active site: Q235 (≠ M236), V270 (≠ Q272), P347 (≠ Y349), I353 (≠ G353), R382 (vs. gap), C383 (vs. gap), E758 (= E781), S759 (≠ G782)
- binding cu(i)-s-mo(iv)(=o)o-nbic cluster: G267 (= G269), V379 (≠ L380), A380 (≠ V381), R382 (vs. gap), C383 (vs. gap), F385 (= F384), Y563 (= Y569), G564 (≠ S570), E758 (= E781)
- binding pterin cytosine dinucleotide: G265 (≠ S267), F266 (= F268), R382 (vs. gap), Q523 (≠ A526), G524 (= G527), Q525 (= Q528), H527 (= H530), T530 (≠ V533), T562 (≠ N568), Y563 (= Y569), G564 (≠ S570), S565 (= S571), S567 (≠ F573), T568 (≠ A574), C681 (≠ A704), I685 (≠ L708), I689 (≠ L712), I690 (≠ A713), Q693 (= Q716), K754 (= K777), G755 (= G778), V756 (≠ L779), G757 (= G780), E758 (= E781)
1n5wB Crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form (see paper)
30% identity, 78% coverage: 14:807/1020 of query aligns to 5:787/804 of 1n5wB
- active site: Q235 (≠ M236), V270 (≠ Q272), P347 (≠ Y349), I353 (≠ G353), R382 (vs. gap), C383 (vs. gap), E758 (= E781), S759 (≠ G782)
- binding cu(i)-s-mo(vi)(=o)oh cluster: G267 (= G269), A380 (≠ V381), R382 (vs. gap), C383 (vs. gap), Y563 (= Y569), G564 (≠ S570), E758 (= E781)
- binding pterin cytosine dinucleotide: G265 (≠ S267), F266 (= F268), R382 (vs. gap), Q523 (≠ A526), G524 (= G527), Q525 (= Q528), H527 (= H530), T530 (≠ V533), T562 (≠ N568), Y563 (= Y569), S565 (= S571), S567 (≠ F573), T568 (≠ A574), C681 (≠ A704), I685 (≠ L708), I689 (≠ L712), I690 (≠ A713), Q693 (= Q716), K754 (= K777), G755 (= G778), V756 (≠ L779), E758 (= E781)
1n63B Crystal structure of the cu,mo-co dehydrogenase (codh); carbon monoxide reduced state (see paper)
30% identity, 78% coverage: 14:807/1020 of query aligns to 6:788/805 of 1n63B
- active site: Q236 (≠ M236), V271 (≠ Q272), P348 (≠ Y349), I354 (≠ G353), R383 (vs. gap), C384 (vs. gap), E759 (= E781), S760 (≠ G782)
- binding cu(i)-s-mo(iv)(=o)oh cluster: G268 (= G269), A381 (≠ V381), R383 (vs. gap), C384 (vs. gap), Y564 (= Y569), G565 (≠ S570), E759 (= E781)
- binding pterin cytosine dinucleotide: G266 (≠ S267), F267 (= F268), R383 (vs. gap), Q524 (≠ A526), G525 (= G527), Q526 (= Q528), H528 (= H530), T531 (≠ V533), T563 (≠ N568), Y564 (= Y569), S566 (= S571), S568 (≠ F573), T569 (≠ A574), C682 (≠ A704), I686 (≠ L708), I690 (≠ L712), I691 (≠ A713), Q694 (= Q716), K755 (= K777), G756 (= G778), V757 (≠ L779), E759 (= E781)
1zxiB Reconstituted co dehydrogenase from oligotropha carboxidovorans (see paper)
30% identity, 78% coverage: 14:807/1020 of query aligns to 5:787/804 of 1zxiB
- active site: Q235 (≠ M236), V270 (≠ Q272), P347 (≠ Y349), I353 (≠ G353), R382 (vs. gap), C383 (vs. gap), E758 (= E781), S759 (≠ G782)
- binding copper (ii) ion: C383 (vs. gap), S384 (≠ G383), E758 (= E781)
- binding cu(i)-s-mo(vi)(=o)oh cluster: F266 (= F268), G267 (= G269), A380 (≠ V381), Y381 (≠ R382), R382 (vs. gap), C383 (vs. gap), Y563 (= Y569), G564 (≠ S570), E758 (= E781)
- binding pterin cytosine dinucleotide: G265 (≠ S267), F266 (= F268), R382 (vs. gap), Q523 (≠ A526), G524 (= G527), Q525 (= Q528), H527 (= H530), T530 (≠ V533), T562 (≠ N568), Y563 (= Y569), S565 (= S571), S567 (≠ F573), T568 (≠ A574), C681 (≠ A704), I685 (≠ L708), I689 (≠ L712), I690 (≠ A713), Q693 (= Q716), K754 (= K777), G755 (= G778), V756 (≠ L779), E758 (= E781)
1rm6A Structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica (see paper)
28% identity, 76% coverage: 42:817/1020 of query aligns to 16:754/761 of 1rm6A
- active site: Q206 (≠ M236), T241 (≠ Q272), Y318 (= Y349), L322 (vs. gap), R350 (= R382), E718 (= E781), G719 (= G782)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): G235 (= G266), G236 (≠ S267), F237 (= F268), G238 (= G269), R350 (= R382), I473 (≠ A526), G474 (= G527), Q475 (= Q528), G476 (= G529), Y513 (= Y569), S514 (= S570), S515 (= S571), V517 (≠ F573), T518 (≠ A574), L646 (= L708), N647 (= N709), V651 (≠ A713), Q654 (= Q716), K714 (= K777), E715 (≠ G778), A716 (≠ L779), S717 (≠ G780), E718 (= E781)
O33819 4-hydroxybenzoyl-CoA reductase subunit alpha; 4-HBCR subunit alpha; EC 1.1.7.1 from Thauera aromatica (see paper)
28% identity, 76% coverage: 42:817/1020 of query aligns to 24:762/769 of O33819
4zohA Crystal structure of glyceraldehyde oxidoreductase (see paper)
27% identity, 77% coverage: 28:808/1020 of query aligns to 2:695/701 of 4zohA
- active site: Q186 (≠ F239), I219 (≠ Q272), V298 (≠ F348), S300 (≠ R350), M304 (≠ C354), R332 (= R382), E668 (= E781), A669 (≠ G782)
- binding pterin cytosine dinucleotide: G213 (= G266), A214 (≠ S267), F215 (= F268), R332 (= R382), H442 (≠ A526), G443 (= G527), Q444 (= Q528), D446 (≠ H530), W482 (≠ Y569), S484 (= S571), T486 (≠ F573), V487 (≠ A574), I594 (≠ L708), N595 (= N709), L598 (= L712), Q602 (= Q716), K664 (= K777), G665 (= G778), I666 (≠ L779), G667 (= G780), E668 (= E781)
3amzA Bovine xanthine oxidoreductase urate bound form (see paper)
24% identity, 81% coverage: 17:845/1020 of query aligns to 525:1285/1291 of 3amzA
- active site: Q731 (≠ S233), E766 (≠ Q272), R844 (≠ A346), H848 (≠ R350), R876 (= R382), G1224 (= G780), E1225 (= E781)
- binding bicarbonate ion: R803 (≠ A308), H804 (≠ T309), T873 (≠ G379), A874 (≠ L380), F878 (= F384), G879 (= G385), Q882 (= Q388)
- binding calcium ion: A831 (≠ C336), S834 (vs. gap), R835 (vs. gap), S838 (≠ V340), S871 (≠ P377), N872 (≠ T378)
- binding fe2/s2 (inorganic) cluster: L708 (≠ A211)
- binding 1,4-dihydronicotinamide adenine dinucleotide: S1189 (≠ A747)
- binding uric acid: E766 (≠ Q272), R844 (≠ A346), F878 (= F384), F973 (= F471), T974 (≠ A472), A1043 (≠ G575), E1225 (= E781)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 44, 229, 230, 231, 232, 233, 234, 235, 236, 309, 318, 319, 322, 323, 325, 326, 331, 332, 375, 376
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 71, 110, 111, 112, 114, 146, 148
- binding 1,4-dihydronicotinamide adenine dinucleotide: 328, 329, 330, 365, 366, 402, 403, 430, 432, 433, 473, 480
3am9A Complex of bovine xanthine dehydrogenase and trihydroxy fyx-051 (see paper)
24% identity, 81% coverage: 17:845/1020 of query aligns to 527:1287/1293 of 3am9A
- active site: Q733 (≠ S233), E768 (≠ Q272), R846 (= R350), H850 (≠ C354), R878 (= R382), G1226 (= G780), E1227 (= E781)
- binding bicarbonate ion: R805 (≠ A308), H806 (≠ T309), T875 (≠ G379), A876 (≠ L380), F877 (≠ V381), Q884 (= Q388)
- binding calcium ion: H707 (≠ N208), Y709 (≠ C210), T802 (≠ A305), G803 (≠ T306), A833 (≠ C336), S836 (≠ V340), R837 (= R341), S840 (≠ E344), S873 (≠ P377), N874 (≠ T378)
- binding fe2/s2 (inorganic) cluster: L710 (≠ A211)
- binding 4-[5-(2,6-dioxo-1,2,3,6-tetrahydropyridin-4-yl)-1H-1,2,4-triazol-3-yl]-6-oxo-1,6-dihydropyridine-2-carbonitrile: L614 (≠ V104), E768 (≠ Q272), L839 (≠ P343), S842 (≠ A346), R846 (= R350), F880 (= F384), F975 (= F471), L980 (≠ I479), A1045 (≠ G575), E1227 (= E781)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 43, 44, 228, 229, 231, 232, 233, 234, 235, 236, 309, 310, 314, 318, 319, 322, 323, 325, 326, 332, 376, 394
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 71, 111, 112, 114, 146, 148
7orcB Human aldehyde oxidase in complex with raloxifene (see paper)
25% identity, 79% coverage: 5:813/1020 of query aligns to 520:1274/1299 of 7orcB
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 43, 44, 228, 229, 230, 231, 232, 233, 234, 235, 236, 309, 310, 318, 319, 322, 323, 326, 328, 331, 332, 376, 403
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 69, 71, 111, 112, 114, 146, 148
- binding raloxifene: 417, 418, 419, 449, 451, 506, 507
Q06278 Aldehyde oxidase; Aldehyde oxidase 1; Azaheterocycle hydroxylase; EC 1.2.3.1; EC 1.17.3.- from Homo sapiens (Human) (see 3 papers)
25% identity, 77% coverage: 29:813/1020 of query aligns to 580:1311/1338 of Q06278
- R802 (≠ D263) to C: decreases homodimerization but nearly no effect on kinetic parameters; dbSNP:rs41309768
- AF 806:807 (≠ SF 267:268) binding
- R921 (= R382) to H: increases homodimerization; abolishes enzymatic activity on phenanthridine; decreases turnover number with benzaldehyde, phtalazine and chloroquinazolinone as substrate, while nearly no effect on the KM; dbSNP:rs56199635
- M1047 (≠ A526) binding
- GSVV 1088:1091 (≠ GNYS 567:570) binding
- N1135 (≠ P625) to S: increases homodimerization and turnover number with phenanthridine as substrate; nearly no effect on kinetic parameters with benzaldehyde, phtalazine and chloroquinazolinone as substrate; dbSNP:rs55754655
- Q1203 (= Q716) binding
- L1268 (= L779) binding
- G1269 (= G780) mutation to R: No effect on dimerization. Loss of oxidase activity.
- S1271 (≠ G782) to L: no effect on dimerization; no effect on oxidase activity; dbSNP:rs141786030
- H1297 (≠ L799) to R: increases homodimerization and turnover number with phenanthridine as substrate; nearly no effect on kinetic parameters with benzaldehyde, phtalazine and chloroquinazolinone as substrate; dbSNP:rs3731722
Sites not aligning to the query:
- 44 binding ; C→W: Disrupts protein stability.
- 49 binding
- 52 binding
- 74 binding
- 113 binding
- 114 binding
- 117 binding
- 149 binding
- 151 binding ; binding
- 264:271 binding
- 345 binding
- 354 binding
- 358 binding
- 367 binding
- 411 binding
1vdvA Bovine milk xanthine dehydrogenase y-700 bound form (see paper)
24% identity, 75% coverage: 17:781/1020 of query aligns to 528:1228/1299 of 1vdvA
- active site: Q734 (≠ S233), E769 (≠ Q272), R847 (= R350), H851 (≠ C354), R879 (= R382), G1227 (= G780), E1228 (= E781)
- binding calcium ion: H708 (≠ N208), Y710 (≠ C210), T803 (≠ A305), G804 (≠ T306), A834 (≠ C336), S837 (≠ V340), R838 (= R341), S841 (≠ E344), S874 (≠ P377), N875 (≠ T378)
- binding fe2/s2 (inorganic) cluster: L711 (≠ A211)
- binding 1-[3-cyano-4-(neopentyloxy)phenyl]-1h-pyrazole-4-carboxylic acid: E769 (≠ Q272), L840 (≠ P343), S843 (≠ A346), R847 (= R350), F881 (= F384), F976 (= F471), T977 (≠ A472), V978 (≠ A473), L981 (≠ I479), P1043 (≠ R572), A1046 (≠ G575)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 43, 44, 229, 230, 231, 232, 233, 234, 235, 236, 309, 310, 318, 319, 322, 323, 325, 326, 331, 332, 375, 376
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 71, 110, 111, 112, 114, 146, 148
1fo4A Crystal structure of xanthine dehydrogenase isolated from bovine milk (see paper)
24% identity, 75% coverage: 17:781/1020 of query aligns to 528:1228/1299 of 1fo4A
- active site: Q734 (≠ S233), E769 (≠ Q272), R847 (= R350), H851 (≠ C354), R879 (= R382), G1227 (= G780), E1228 (= E781)
- binding calcium ion: A834 (≠ C336), S837 (≠ V340), R838 (= R341), S841 (≠ E344), S874 (≠ P377), N875 (≠ T378)
- binding fe2/s2 (inorganic) cluster: L711 (≠ A211)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 43, 44, 228, 229, 230, 231, 232, 233, 234, 235, 236, 309, 310, 318, 319, 322, 323, 325, 331, 332, 375, 376
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 71, 110, 111, 112, 114, 146, 147, 148
Query Sequence
>H281DRAFT_01141 FitnessBrowser__Burk376:H281DRAFT_01141
MNQRDLVSTADAATQDREADAAQGVQRHVGRPMQRLEDPAILTGRGRYGDDIGVRPGTLH
AAVLRSPHAHAELLAIDTQAAAQLQGVRAILTRDDLRAWSRPFVVGVKSPMEQWALAMDR
VRYVGEPVAVVLAETRALAEDALDLIKVEYATLEPVTSIEEAVGDSAVLHEKVGSNVISD
RHFRYGEPEAAFEKAPHRVKLVAHYPRNTCAPIECGVVIAEYLAGDEGYDVTSNFMGPFS
LHAVMAMALNVPANRLRHKAPRDSGGSFGVKQAVFPYVVLMCLASRKAGAPVKWVEDRLE
HLSAATSATARLSTLEAAVENDGRITALSYDQLEDCGAYVRAPEPATFYRMHGCLTGAYA
IDNLLVRNRVVLTSKTPTGLVRGFGGPQVYFALERLMQRIAVELGLDVLDVYRRNFVRAD
AFPYRAAAGALLDSGNYQEALRRALDEGGYDELRARREAARSEGRLYGIGFAAIVEPSIS
NMGYITTVMPAEARRKAGPKSGAIASATVSVDLLGGVVVTIASTPAGQGHMTVCAQVVAD
VLGIAPHEVAVNVEFDTHKDAWSVAAGNYSSRFAGAVAGTVHLAAMRVRDKIARIVSKQL
NCAPQDVRFEGGRIFAQGAEDRAQPFGRVAANAPHWAPALLPEGEEPGLRETVFWNPPNM
AAPDENDRVNTSAAYGFAFDMCGVEVDRATGRVRIDRYVTAHDAGTLLNPALADGQIRGA
FAQGLGAALMEEFRYGADGSFQSGTLADYLMPTACEVPDPVIVHLETPSPFTPLGAKGLG
EGNNMSTPPCIANAVADALGVDDIRLPLTPSKVMALIGIDDPEPSRPELREAPAPKNPAM
SGSGKALTAQGSVDLPATPEAVFAVLLDPKALAKVIPGCHALETEGPNQYRADVTVGVGM
IKARFEAKIGLSEIDAPHRLRLAGAGISSLGSARGSGLVELTPIATGTRLSYDYEAQVSG
KVAAVGARMLEGAAKVVLRQLFESLGRQAAGKPLDASAHSSGEGGGSWLSRLLARFRRQR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory