Comparing H281DRAFT_01156 FitnessBrowser__Burk376:H281DRAFT_01156 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
8gxkB Pseudomonas jinjuensis n-acetyltransferase (see paper)
44% identity, 70% coverage: 53:187/192 of query aligns to 52:184/188 of 8gxkB
Sites not aligning to the query:
1yreB Hypothetical protein pa3270 from pseudomonas aeruginosa in complex with coa
37% identity, 80% coverage: 37:189/192 of query aligns to 37:186/187 of 1yreB
8gxfB Pseudomonas flexibilis gcn5 family acetyltransferase (see paper)
35% identity, 93% coverage: 12:189/192 of query aligns to 15:186/187 of 8gxfB
6c37A Mycobacterium smegmatis rimj in complex with coa-disulfide
28% identity, 80% coverage: 30:183/192 of query aligns to 51:197/209 of 6c37A
Sites not aligning to the query:
6c32A Mycobacterium smegmatis rimj with accoa
28% identity, 80% coverage: 30:183/192 of query aligns to 51:197/209 of 6c32A
Sites not aligning to the query:
>H281DRAFT_01156 FitnessBrowser__Burk376:H281DRAFT_01156
MQLTLIGKTVELRPLERDHAQALLDAAADGQLWNLKLTVVPGPDTIGGYIDTALAGRDAG
TVMPFVIVRRETGTVIGSTRFWKIDRANRKLEIGHTWLCASAQRSAANTEAKYLLLRHAF
EAMQCVRVQFTTDELNDKSRAAILRIGAKQEGVVRHERIMPDGRKRNSVRFSIIDDEWAQ
VKAMLETKLGPR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory