SitesBLAST
Comparing H281DRAFT_01159 FitnessBrowser__Burk376:H281DRAFT_01159 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4za2D Crystal structure of pectobacterium carotovorum 2-keto-3-deoxy-d- gluconate dehydrogenase complexed with NAD+ (see paper)
66% identity, 94% coverage: 17:266/266 of query aligns to 4:247/247 of 4za2D
- binding nicotinamide-adenine-dinucleotide: G17 (= G30), D19 (≠ N32), L22 (= L35), I42 (≠ R55), D65 (= D78), M66 (≠ L79), N92 (= N105), A93 (= A106), G94 (= G107), L115 (= L128), I143 (= I156), S145 (= S158), Y158 (= Y171), K162 (= K175), G189 (= G202), M191 (= M204), T193 (= T206), N195 (= N208)
4hp8B Crystal structure of a putative 2-deoxy-d-gluconate 3-dehydrogenase from agrobacterium tumefaciens (target efi-506435) with bound NADP
56% identity, 94% coverage: 17:266/266 of query aligns to 2:246/246 of 4hp8B
- active site: G19 (= G34), S138 (= S158), V148 (= V168), Y151 (= Y171), K155 (= K175)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G30), N17 (= N32), T18 (= T33), G19 (= G34), L20 (= L35), R40 (= R55), R41 (≠ A56), D63 (= D78), F64 (≠ L79), N85 (= N105), G87 (= G107), I88 (= I108), I136 (= I156), Y151 (= Y171), K155 (= K175), P181 (= P201), G182 (= G202), I184 (≠ M204), T186 (= T206), N188 (= N208), T189 (= T209)
3uf0A Crystal structure of a putative NAD(p) dependent gluconate 5- dehydrogenase from beutenbergia cavernae(efi target efi-502044) with bound NADP (low occupancy)
48% identity, 93% coverage: 18:265/266 of query aligns to 2:248/249 of 3uf0A
- active site: G18 (= G34), S141 (= S158), V151 (= V168), Y154 (= Y171), K158 (= K175)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G14 (= G30), S17 (≠ T33), G18 (= G34), I19 (≠ L35), R39 (= R55), D63 (= D78), L64 (= L79), N89 (= N105), G91 (= G107), I92 (= I108), I139 (= I156), A140 (= A157), S141 (= S158), Y154 (= Y171), K158 (= K175), P184 (= P201), G185 (= G202), V187 (≠ M204), T189 (= T206), N191 (= N208), T192 (= T209)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
42% identity, 92% coverage: 21:264/266 of query aligns to 3:246/247 of 4jroC
- active site: G16 (= G34), S142 (= S158), Q152 (≠ V168), Y155 (= Y171), K159 (= K175)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G30), S14 (≠ N32), R15 (≠ T33), G16 (= G34), I17 (≠ L35), N35 (vs. gap), Y36 (vs. gap), N37 (≠ G52), G38 (≠ V53), S39 (= S54), N63 (≠ D78), V64 (≠ L79), N90 (= N105), A91 (= A106), I93 (= I108), I113 (≠ L128), S142 (= S158), Y155 (= Y171), K159 (= K175), P185 (= P201), I188 (≠ M204), T190 (= T206)
1vl8B Crystal structure of gluconate 5-dehydrogenase (tm0441) from thermotoga maritima at 2.07 a resolution
41% identity, 93% coverage: 19:265/266 of query aligns to 2:251/252 of 1vl8B
- active site: G17 (= G34), S143 (= S158), I154 (≠ V168), Y157 (= Y171), K161 (= K175)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G30), R16 (≠ T33), G17 (= G34), L18 (= L35), S37 (= S54), R38 (= R55), C63 (≠ A77), D64 (= D78), V65 (≠ L79), A91 (≠ N105), A92 (= A106), G93 (= G107), I94 (= I108), V114 (≠ L128), I141 (= I156), S143 (= S158), Y157 (= Y171), K161 (= K175), P187 (= P201), G188 (= G202), Y190 (≠ M204), T192 (= T206), M194 (≠ N208), T195 (= T209)
1edoA The x-ray structure of beta-keto acyl carrier protein reductase from brassica napus complexed with NADP+ (see paper)
41% identity, 89% coverage: 25:262/266 of query aligns to 3:241/244 of 1edoA
- active site: G12 (= G34), S138 (= S158), Y151 (= Y171), K155 (= K175)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G30), S10 (≠ N32), R11 (≠ T33), I13 (≠ L35), N31 (≠ G52), Y32 (≠ V53), A33 (≠ S54), R34 (= R55), S35 (≠ A56), D59 (= D78), V60 (≠ L79), N86 (= N105), A87 (= A106), S138 (= S158), Y151 (= Y171), K155 (= K175), P181 (= P201), G182 (= G202), I184 (≠ M204), S186 (≠ T206), M188 (≠ N208)
5u9pB Crystal structure of a gluconate 5-dehydrogenase from burkholderia cenocepacia j2315 in complex with NADP and tartrate
42% identity, 94% coverage: 14:262/266 of query aligns to 7:256/261 of 5u9pB
- active site: G27 (= G34), S152 (= S158), Y165 (= Y171), K169 (= K175)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G23 (= G30), R26 (≠ T33), G27 (= G34), I28 (≠ L35), R48 (= R55), D73 (= D87), V74 (≠ I88), N100 (= N105), A101 (= A106), I150 (= I156), Y165 (= Y171), K169 (= K175), P195 (= P201), F198 (≠ M204), T200 (= T206), L202 (≠ N208), N203 (≠ T209)
3op4A Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. N16961 in complex with NADP+ (see paper)
37% identity, 92% coverage: 19:263/266 of query aligns to 4:244/247 of 3op4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G30), S17 (≠ N32), R18 (≠ T33), I20 (≠ L35), T40 (≠ R55), N62 (≠ D78), V63 (≠ L79), N89 (= N105), A90 (= A106), I92 (= I108), V139 (≠ I156), S141 (= S158), Y154 (= Y171), K158 (= K175), P184 (= P201), G185 (= G202), I187 (≠ M204), T189 (= T206), M191 (≠ N208)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
39% identity, 92% coverage: 21:264/266 of query aligns to 5:243/244 of 4nbuB
- active site: G18 (= G34), N111 (= N129), S139 (= S158), Q149 (≠ V168), Y152 (= Y171), K156 (= K175)
- binding acetoacetyl-coenzyme a: D93 (≠ R111), K98 (≠ D116), S139 (= S158), N146 (≠ G165), V147 (≠ I166), Q149 (≠ V168), Y152 (= Y171), F184 (≠ Y203), M189 (≠ N208), K200 (≠ E221)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G30), N17 (≠ T33), G18 (= G34), I19 (≠ L35), D38 (≠ S54), F39 (≠ R55), V59 (≠ A77), D60 (= D78), V61 (≠ L79), N87 (= N105), A88 (= A106), G89 (= G107), I90 (= I108), T137 (≠ I156), S139 (= S158), Y152 (= Y171), K156 (= K175), P182 (= P201), F184 (≠ Y203), T185 (≠ M204), T187 (= T206), M189 (≠ N208)
3o03A Quaternary complex structure of gluconate 5-dehydrogenase from streptococcus suis type 2 (see paper)
39% identity, 93% coverage: 19:265/266 of query aligns to 7:248/254 of 3o03A
- active site: G22 (= G34), S147 (= S158), V157 (= V168), Y160 (= Y171), K164 (= K175)
- binding calcium ion: S147 (= S158), M148 (= M159), P190 (= P201)
- binding D-gluconic acid: I99 (= I109), R101 (= R111), S147 (= S158), M149 (≠ L160), R154 (≠ G165), Y160 (= Y171)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G30), Y21 (≠ T33), G22 (= G34), I23 (≠ L35), D42 (vs. gap), I43 (vs. gap), L47 (vs. gap), D68 (= D78), V69 (≠ L79), N95 (= N105), A96 (= A106), G97 (= G107), I145 (= I156), Y160 (= Y171), K164 (= K175), P190 (= P201)
4i08A Crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg) from vibrio cholerae in complex with NADPH (see paper)
36% identity, 92% coverage: 19:263/266 of query aligns to 4:240/243 of 4i08A
- active site: G19 (= G34), N113 (= N129), S141 (= S158), Q151 (≠ V168), Y154 (= Y171), K158 (= K175)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G15 (= G30), S17 (≠ N32), R18 (≠ T33), I20 (≠ L35), T40 (≠ R55), N62 (≠ D78), V63 (≠ L79), N89 (= N105), A90 (= A106), G140 (≠ A157), S141 (= S158), Y154 (= Y171), K158 (= K175), P184 (= P201), G185 (= G202), T189 (= T206)
4dmmB 3-oxoacyl-[acyl-carrier-protein] reductase from synechococcus elongatus pcc 7942 in complex with NADP
40% identity, 92% coverage: 19:264/266 of query aligns to 1:238/240 of 4dmmB
- active site: G16 (= G34), S142 (= S158), Q152 (≠ V168), Y155 (= Y171), K159 (= K175)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G30), S14 (≠ N32), R15 (≠ T33), G16 (= G34), I17 (≠ L35), A37 (≠ R55), S38 (≠ A56), S39 (≠ D57), A62 (= A77), D63 (= D78), V64 (≠ L79), N90 (= N105), A91 (= A106), L113 (= L128), I140 (= I156), S142 (= S158), Y155 (= Y171), K159 (= K175), P185 (= P201), G186 (= G202), I188 (≠ M204), T190 (= T206), M192 (≠ N208)
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
37% identity, 90% coverage: 24:263/266 of query aligns to 5:244/246 of 3osuA
P73574 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-acyl carrier protein reductase; EC 1.1.1.100 from Synechocystis sp. (strain PCC 6803 / Kazusa) (see paper)
39% identity, 92% coverage: 21:264/266 of query aligns to 4:245/247 of P73574
- A14 (≠ S31) mutation to G: 4.2-fold increase in activity on acetoacetyl-CoA.
- P151 (≠ I166) mutation to F: 2.7-fold increase in activity on acetoacetyl-CoA.; mutation to V: 5.7-fold increase in activity on acetoacetyl-CoA.
- K160 (= K175) mutation to A: Almost no activity on acetoacetyl-CoA.
- F188 (≠ Y203) mutation to Y: 3.3-fold increase in activity on acetoacetyl-CoA.
- N198 (≠ R213) mutation to R: 3.5-fold increase in activity on acetoacetyl-CoA.
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
37% identity, 90% coverage: 24:263/266 of query aligns to 2:237/239 of 3sj7A
- active site: G12 (= G34), S138 (= S158), Q148 (≠ V168), Y151 (= Y171), K155 (= K175)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G30), S10 (≠ N32), R11 (≠ T33), I13 (≠ L35), N31 (vs. gap), Y32 (≠ V51), A33 (≠ G52), G34 (≠ V53), S35 (= S54), A58 (= A77), N59 (≠ D78), V60 (≠ L79), N86 (= N105), A87 (= A106), T109 (≠ L128), S138 (= S158), Y151 (= Y171), K155 (= K175), P181 (= P201), G182 (= G202)
6t77A Crystal structure of klebsiella pneumoniae fabg(NADPH-dependent) NADP- complex at 1.75 a resolution (see paper)
36% identity, 91% coverage: 23:263/266 of query aligns to 5:241/244 of 6t77A
- active site: G16 (= G34), S138 (= S158), Y151 (= Y171)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G30), S14 (≠ N32), R15 (≠ T33), T37 (≠ R55), L58 (≠ A77), N59 (≠ D78), V60 (≠ L79), A87 (= A106), G88 (= G107), I89 (= I108)
2ztlA Closed conformation of d-3-hydroxybutyrate dehydrogenase complexed with NAD+ and l-3-hydroxybutyrate (see paper)
41% identity, 92% coverage: 21:266/266 of query aligns to 2:260/260 of 2ztlA
- active site: G15 (= G34), N114 (= N129), S142 (= S158), Y155 (= Y171), K159 (= K175), L200 (= L212)
- binding (3s)-3-hydroxybutanoic acid: Q94 (≠ I109), S142 (= S158), H144 (≠ L160), K152 (≠ V168), Y155 (= Y171), Q196 (≠ N208)
- binding nicotinamide-adenine-dinucleotide: G11 (= G30), G15 (= G34), I16 (≠ L35), F36 (≠ R55), L64 (= L79), N90 (= N105), A91 (= A106), G92 (= G107), L113 (= L128), Y155 (= Y171), K159 (= K175), P185 (= P201), W187 (≠ Y203), V188 (≠ M204), T190 (= T206), V193 (vs. gap)
1wmbA Crystal structure of NAD dependent d-3-hydroxybutylate dehydrogenase (see paper)
41% identity, 92% coverage: 21:266/266 of query aligns to 2:260/260 of 1wmbA
7tzpG Crystal structure of putataive short-chain dehydrogenase/reductase (fabg) from klebsiella pneumoniae subsp. Pneumoniae ntuh-k2044 in complex with nadh (see paper)
38% identity, 94% coverage: 16:264/266 of query aligns to 1:246/247 of 7tzpG
- binding 1,4-dihydronicotinamide adenine dinucleotide: G15 (= G30), R18 (≠ T33), G19 (= G34), I20 (≠ L35), D39 (≠ S54), R40 (= R55), C63 (≠ A77), I65 (≠ L79), N91 (= N105), G93 (= G107), I94 (= I108), V114 (≠ L128), Y155 (= Y171), K159 (= K175), I188 (≠ M204), T190 (= T206), T193 (= T209)
P0AEK2 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Escherichia coli (strain K12) (see 2 papers)
36% identity, 92% coverage: 19:263/266 of query aligns to 1:241/244 of P0AEK2
- GASR 12:15 (≠ GSNT 30:33) binding
- T37 (≠ R55) binding
- NV 59:60 (≠ DL 78:79) binding
- N86 (= N105) binding
- Y151 (= Y171) mutation to F: Defect in the affinity for NADPH.
- YAAAK 151:155 (≠ YTASK 171:175) binding
- A154 (≠ S174) mutation to T: Decreases in the thermolability of the reductase; when associated with K-233.
- K155 (= K175) mutation to A: Defect in the affinity for NADPH.
- I184 (≠ M204) binding
- E233 (≠ H255) mutation to K: Decreases in the thermolability of the reductase; when associated with T-154.
Query Sequence
>H281DRAFT_01159 FitnessBrowser__Burk376:H281DRAFT_01159
MGSDIVTIPAINRSAANPFDLGGKVAIVTGSNTGLGAGMALALAQAGCDIVGVSRADAGD
TPARVEVTGRRFADVRADLSSTAPVEDIVRAAVEAFGRIDVLVNNAGIIRRQDALDFTED
DWDAVMDLNLKSLFFLAQAAARQFVKQQSGGKIINIASMLSFQGGIRVASYTASKSGVLG
LTRLLANEWAAKRINVNAIAPGYMATANTAALREDAQRNDEILSRIPAGRWGAPDDLAGP
VVFLASSASDYVHGHTLAVDGGWLAR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory