Comparing H281DRAFT_01167 FitnessBrowser__Burk376:H281DRAFT_01167 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 9 hits to proteins with known functional sites (download)
P04968 L-threonine dehydratase biosynthetic IlvA; Threonine deaminase; EC 4.3.1.19 from Escherichia coli (strain K12) (see paper)
53% identity, 99% coverage: 3:281/281 of query aligns to 235:513/514 of P04968
Sites not aligning to the query:
1tdjA Threonine deaminase (biosynthetic) from e. Coli (see paper)
51% identity, 99% coverage: 3:281/281 of query aligns to 231:493/494 of 1tdjA
Sites not aligning to the query:
1ve5D Crystal structure of t.Th. Hb8 threonine deaminase
35% identity, 30% coverage: 7:90/281 of query aligns to 199:279/280 of 1ve5D
Sites not aligning to the query:
1ve5A Crystal structure of t.Th. Hb8 threonine deaminase
35% identity, 30% coverage: 7:90/281 of query aligns to 227:307/308 of 1ve5A
Sites not aligning to the query:
1wtcA Crystal structure of s.Pombe serine racemase complex with amppcp (see paper)
31% identity, 31% coverage: 6:91/281 of query aligns to 228:311/318 of 1wtcA
Sites not aligning to the query:
1v71A Crystal structure of s.Pombe serine racemase
31% identity, 31% coverage: 6:91/281 of query aligns to 228:311/318 of 1v71A
Sites not aligning to the query:
2zr8A Crystal structure of modified serine racemase complexed with serine (see paper)
31% identity, 31% coverage: 6:91/281 of query aligns to 229:312/319 of 2zr8A
Sites not aligning to the query:
2zpuA Crystal structure of modified serine racemase from s.Pombe. (see paper)
31% identity, 31% coverage: 6:91/281 of query aligns to 229:312/319 of 2zpuA
Sites not aligning to the query:
O59791 Serine racemase; D-serine ammonia-lyase; D-serine dehydratase; L-serine ammonia-lyase; L-serine dehydratase; EC 4.3.1.17; EC 4.3.1.18; EC 5.1.1.18 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
31% identity, 31% coverage: 6:91/281 of query aligns to 233:316/323 of O59791
Sites not aligning to the query:
>H281DRAFT_01167 FitnessBrowser__Burk376:H281DRAFT_01167
NEVGLFSDGTAVKLVGEETFRLCSEYLDDVLLVNTDALCAAIKDVFQDTRSVLEPAGSLA
VAGAKQYAEREGVENQTLIAITSGANMNFDRMRFVAERAEVGEAREAVFAVTIPEERGSF
RRFCELVGTRSVTEFNYRIAQAESAHIFVGVQIRNRSESAQIAGAFEAHNFATVDLTFDE
LSKQHIRYMVGGRSPLAHDERLFRFEFPERPGALMKFLSSMAPDWNISLFHYRNQGADYS
SILVGIQVPQTDNAEFERFLATLGYPHWEETHNSVYRLFLA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory