SitesBLAST
Comparing H281DRAFT_01171 FitnessBrowser__Burk376:H281DRAFT_01171 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2eerB Structural study of project id st2577 from sulfolobus tokodaii strain7
34% identity, 98% coverage: 1:348/356 of query aligns to 1:345/347 of 2eerB
- active site: C38 (= C38), H39 (= H39), S40 (≠ T40), H43 (= H43), H68 (= H72), E69 (= E73), E98 (≠ C102), C101 (= C105), C104 (= C108), C112 (= C116), R116 (= R120), C154 (= C158), T158 (= T162), R342 (= R345)
- binding nicotinamide-adenine-dinucleotide: C38 (= C38), H39 (= H39), S40 (≠ T40), H43 (= H43), C154 (= C158), T158 (= T162), G178 (= G183), G181 (= G185), G182 (= G186), L183 (≠ V187), D203 (= D207), V204 (= V208), R205 (≠ S209), L247 (≠ F250), N248 (≠ V251), V270 (≠ C273), G271 (= G274), L272 (= L275), F273 (≠ H276), L295 (≠ F298), V296 (= V299), R342 (= R345)
- binding zinc ion: E98 (≠ C102), C101 (= C105), C104 (= C108), C112 (= C116)
1r37A Alcohol dehydrogenase from sulfolobus solfataricus complexed with NAD(h) and 2-ethoxyethanol (see paper)
33% identity, 98% coverage: 1:348/356 of query aligns to 1:345/347 of 1r37A
- active site: C38 (= C38), H39 (= H39), S40 (≠ T40), H43 (= H43), H68 (= H72), E69 (= E73), E98 (≠ C102), C101 (= C105), C104 (= C108), C112 (= C116), R116 (= R120), C154 (= C158), T158 (= T162), R342 (= R345)
- binding 2-ethoxyethanol: S40 (≠ T40), F49 (= F49)
- binding nicotinamide-adenine-dinucleotide: C38 (= C38), H39 (= H39), S40 (≠ T40), H43 (= H43), C154 (= C158), T158 (= T162), G181 (= G185), G182 (= G186), L183 (≠ V187), D203 (= D207), V204 (= V208), R205 (≠ S209), L247 (≠ F250), N248 (≠ V251), V270 (≠ C273), G271 (= G274), L272 (= L275), F273 (≠ H276), L295 (≠ F298), V296 (= V299), L334 (= L337), F337 (≠ G340), R342 (= R345)
- binding zinc ion: C38 (= C38), H68 (= H72), E98 (≠ C102), C101 (= C105), C104 (= C108), C112 (= C116), C154 (= C158)
1jvbA Alcohol dehydrogenase from the archaeon sulfolobus solfataricus (see paper)
33% identity, 98% coverage: 1:348/356 of query aligns to 1:345/347 of 1jvbA
- active site: C38 (= C38), H39 (= H39), S40 (≠ T40), H43 (= H43), H68 (= H72), E69 (= E73), E98 (≠ C102), C101 (= C105), C104 (= C108), C112 (= C116), R116 (= R120), C154 (= C158), T158 (= T162), R342 (= R345)
- binding zinc ion: C38 (= C38), H68 (= H72), E69 (= E73), E98 (≠ C102), C101 (= C105), C104 (= C108), C112 (= C116), C154 (= C158)
P39462 NAD-dependent alcohol dehydrogenase; EC 1.1.1.1 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
33% identity, 98% coverage: 1:348/356 of query aligns to 1:345/347 of P39462
- K11 (≠ R11) modified: N6-methyllysine; partial
- K213 (≠ R217) modified: N6-methyllysine; partial
5o9dA Crystal structure of r. Ruber adh-a, mutant y294f, w295a, y54f, f43h, h39y (see paper)
36% identity, 98% coverage: 1:348/356 of query aligns to 1:343/346 of 5o9dA
- active site: C38 (= C38), Y39 (≠ H39), S40 (≠ T40), H43 (= H43), H62 (= H72), E63 (= E73), C92 (= C102), C95 (= C105), C98 (= C108), C106 (= C116), A110 (≠ R120), D153 (≠ C158), T157 (= T162), R340 (= R345)
- binding (2~{S})-2-methylpentanedioic acid: S40 (≠ T40), H62 (= H72), D153 (≠ C158), F294 (= F298)
- binding nicotinamide-adenine-dinucleotide: C38 (= C38), Y39 (≠ H39), S40 (≠ T40), H43 (= H43), D153 (≠ C158), T157 (= T162), V180 (≠ C184), G181 (= G185), G182 (= G186), L183 (≠ V187), D203 (= D207), L204 (≠ V208), R208 (≠ K212), S223 (≠ T227), F246 (= F250), V247 (= V251), T252 (= T256), V269 (≠ C273), G270 (= G274), I271 (≠ L275), F294 (= F298), R340 (= R345)
- binding zinc ion: C38 (= C38), H62 (= H72), C92 (= C102), C95 (= C105), C98 (= C108), C106 (= C116), D153 (≠ C158)
1rjwA Crystal structure of NAD(+)-dependent alcohol dehydrogenase from bacillus stearothermophilus strain lld-r (see paper)
33% identity, 97% coverage: 6:352/356 of query aligns to 6:338/339 of 1rjwA
- active site: C38 (= C38), H39 (= H39), T40 (= T40), H43 (= H43), H61 (= H72), E62 (= E73), C92 (= C102), C95 (= C105), C98 (= C108), C106 (= C116), K110 (≠ R120), C148 (= C158), T152 (= T162), R331 (= R345)
- binding trifluoroethanol: T40 (= T40), C148 (= C158), I285 (≠ F298)
- binding zinc ion: C38 (= C38), H61 (= H72), C92 (= C102), C95 (= C105), C98 (= C108), C106 (= C116)
P12311 Alcohol dehydrogenase; ADH-T; EC 1.1.1.1 from Geobacillus stearothermophilus (Bacillus stearothermophilus) (see paper)
33% identity, 96% coverage: 6:348/356 of query aligns to 6:334/337 of P12311
- C38 (= C38) mutation to S: No activity.
- T40 (= T40) mutation to A: No activity.; mutation to S: Little decrease in activity.
- H43 (= H43) mutation to A: No activity.; mutation to R: Higher level of activity at pH 9.
6ffxA Crystal structure of r. Ruber adh-a, mutant f43h (see paper)
36% identity, 98% coverage: 1:348/356 of query aligns to 1:343/346 of 6ffxA
- active site: C38 (= C38), S40 (≠ T40), H43 (= H43), H62 (= H72), D153 (≠ C158)
- binding nicotinamide-adenine-dinucleotide: C38 (= C38), H39 (= H39), S40 (≠ T40), H43 (= H43), D153 (≠ C158), T157 (= T162), V180 (≠ C184), G181 (= G185), G182 (= G186), L183 (≠ V187), D203 (= D207), L204 (≠ V208), R208 (≠ K212), S223 (≠ T227), F246 (= F250), V247 (= V251), V269 (≠ C273), R340 (= R345)
- binding zinc ion: C38 (= C38), H62 (= H72), C92 (= C102), C95 (= C105), C98 (= C108), C106 (= C116), D153 (≠ C158)
3piiA Crystal structure of mutant of ht- alcohol dehydrogenase with substrate analogue butyramide
34% identity, 96% coverage: 6:348/356 of query aligns to 6:334/337 of 3piiA
- active site: C38 (= C38), H39 (= H39), T40 (= T40), H43 (= H43), H61 (= H72), E62 (= E73), C92 (= C102), C95 (= C105), C98 (= C108), C106 (= C116), K110 (≠ R120), C148 (= C158), T152 (= T162), R331 (= R345)
- binding butyramide: T40 (= T40), H61 (= H72), W87 (= W99), C148 (= C158)
- binding zinc ion: C38 (= C38), H61 (= H72), E62 (= E73), C92 (= C102), C95 (= C105), C98 (= C108), C106 (= C116), C148 (= C158)
6iqdA Crystal structure of alcohol dehydrogenase from geobacillus stearothermophilus (see paper)
31% identity, 97% coverage: 6:350/356 of query aligns to 6:336/336 of 6iqdA
- active site: C38 (= C38), T40 (= T40), H43 (= H43), H61 (= H72), C148 (= C158)
- binding zinc ion: C38 (= C38), H61 (= H72), E62 (= E73), C92 (= C102), C95 (= C105), C98 (= C108), C106 (= C116), C148 (= C158)
4z6kA Alcohol dehydrogenase from the antarctic psychrophile moraxella sp. Tae 123
32% identity, 97% coverage: 8:354/356 of query aligns to 8:340/345 of 4z6kA
- active site: C38 (= C38), H39 (= H39), T40 (= T40), H43 (= H43), H61 (= H72), E62 (= E73), C92 (= C102), C95 (= C105), C98 (= C108), C106 (= C116), Q110 (≠ R120), C148 (= C158), T152 (= T162), R331 (= R345)
- binding zinc ion: C38 (= C38), H61 (= H72), C92 (= C102), C95 (= C105), C98 (= C108), C106 (= C116), C148 (= C158)
Q8GIX7 Alcohol dehydrogenase; ADH; EC 1.1.1.1 from Moraxella sp. (strain TAE123) (see paper)
32% identity, 97% coverage: 8:351/356 of query aligns to 8:337/338 of Q8GIX7
- C38 (= C38) binding
- H61 (= H72) binding
- E62 (= E73) binding
- C92 (= C102) binding
- C95 (= C105) binding
- C98 (= C108) binding
- C106 (= C116) binding
- C148 (= C158) binding
1h2bB Crystal structure of the alcohol dehydrogenase from the hyperthermophilic archaeon aeropyrum pernix at 1.65a resolution (see paper)
32% identity, 96% coverage: 8:348/356 of query aligns to 8:342/344 of 1h2bB
- active site: C39 (= C38), H40 (= H39), T41 (= T40), H44 (= H43), H64 (= H72), E65 (= E73), D94 (≠ C102), C97 (= C105), C100 (= C108), C108 (= C116), E112 (≠ R120), D153 (≠ C158), T157 (= T162), R339 (= R345)
- binding nicotinamide-adenine-dinucleotide (acidic form): C39 (= C38), H40 (= H39), T41 (= T40), H44 (= H43), T157 (= T162), V180 (≠ C184), G181 (= G185), G182 (= G186), L183 (≠ V187), D203 (= D207), V204 (= V208), K208 (= K212), F246 (= F250), V247 (= V251), T252 (= T256), Y255 (≠ L259), V269 (≠ C273), G270 (= G274), Y271 (≠ H276), L293 (≠ F298), V294 (= V299), R339 (= R345)
- binding octanoic acid (caprylic acid): T41 (= T40), W50 (≠ F49), H64 (= H72), D153 (≠ C158), V294 (= V299)
- binding zinc ion: C39 (= C38), H64 (= H72), D94 (≠ C102), C97 (= C105), C100 (= C108), C108 (= C116), D153 (≠ C158)
1lluA The ternary complex of pseudomonas aeruginosa alcohol dehydrogenase with its coenzyme and weak substrate (see paper)
33% identity, 98% coverage: 1:350/356 of query aligns to 6:341/341 of 1lluA
- active site: C43 (= C38), H44 (= H39), T45 (= T40), H48 (= H43), H66 (= H72), E67 (= E73), C97 (= C102), C100 (= C105), C103 (= C108), C111 (= C116), Q115 (≠ R120), C153 (= C158), T157 (= T162), R336 (= R345)
- binding 1,2-ethanediol: H44 (= H39), T45 (= T40), L47 (= L42), D53 (≠ Y48), W92 (= W99), C153 (= C158)
- binding nicotinamide-adenine-dinucleotide: C43 (= C38), H44 (= H39), T45 (= T40), H48 (= H43), C153 (= C158), T157 (= T162), G179 (= G185), G180 (= G186), L181 (≠ V187), D200 (= D207), I201 (≠ V208), K205 (= K212), A243 (≠ F250), V244 (= V251), S245 (≠ G252), A248 (≠ T256), V265 (≠ C273), L267 (= L275), I290 (≠ F298), V291 (= V299), R336 (= R345)
- binding zinc ion: C43 (= C38), H66 (= H72), C100 (= C105), C103 (= C108), C111 (= C116), C153 (= C158)
3s2fE Crystal structure of furx nadh:furfural
32% identity, 99% coverage: 1:351/356 of query aligns to 3:339/340 of 3s2fE
- active site: C40 (= C38), H41 (= H39), T42 (= T40), H45 (= H43), H63 (= H72), E64 (= E73), C94 (= C102), C97 (= C105), C100 (= C108), C108 (= C116), Q112 (≠ R120), C150 (= C158), T154 (= T162), R333 (= R345)
- binding furfural: T42 (= T40), W51 (≠ F49), H63 (= H72), W89 (= W99), C150 (= C158), I287 (≠ F298)
- binding nicotinamide-adenine-dinucleotide: C40 (= C38), H41 (= H39), T42 (= T40), C150 (= C158), T154 (= T162), G174 (= G183), G176 (= G185), G177 (= G186), L178 (≠ V187), D197 (= D207), I198 (≠ V208), K202 (= K212), T239 (≠ D249), A240 (≠ F250), V241 (= V251), N262 (≠ C273), G263 (= G274), L264 (= L275), I287 (≠ F298), V288 (= V299), R333 (= R345)
- binding zinc ion: C40 (= C38), H63 (= H72), C94 (= C102), C97 (= C105), C100 (= C108), C108 (= C116), C150 (= C158)
3s2fA Crystal structure of furx nadh:furfural
32% identity, 99% coverage: 1:351/356 of query aligns to 3:339/340 of 3s2fA
- active site: C40 (= C38), H41 (= H39), T42 (= T40), H45 (= H43), H63 (= H72), E64 (= E73), C94 (= C102), C97 (= C105), C100 (= C108), C108 (= C116), Q112 (≠ R120), C150 (= C158), T154 (= T162), R333 (= R345)
- binding phosphorylisopropane: T42 (= T40), H63 (= H72), W89 (= W99), I287 (≠ F298)
- binding zinc ion: C40 (= C38), H63 (= H72), E64 (= E73), C94 (= C102), C97 (= C105), C100 (= C108), C108 (= C116), C150 (= C158)
3s2eE Crystal structure of furx nadh complex 1
32% identity, 99% coverage: 1:351/356 of query aligns to 3:339/340 of 3s2eE
- active site: C40 (= C38), H41 (= H39), T42 (= T40), H45 (= H43), H63 (= H72), E64 (= E73), C94 (= C102), C97 (= C105), C100 (= C108), C108 (= C116), Q112 (≠ R120), C150 (= C158), T154 (= T162), R333 (= R345)
- binding nicotinamide-adenine-dinucleotide: C40 (= C38), H41 (= H39), T42 (= T40), C150 (= C158), T154 (= T162), G176 (= G185), G177 (= G186), L178 (≠ V187), D197 (= D207), I198 (≠ V208), K202 (= K212), T239 (≠ D249), A240 (≠ F250), V241 (= V251), S242 (≠ G252), A245 (≠ T256), N262 (≠ C273), G263 (= G274), L264 (= L275), I287 (≠ F298), V288 (= V299)
- binding zinc ion: C40 (= C38), H63 (= H72), C94 (= C102), C97 (= C105), C100 (= C108), C108 (= C116), C150 (= C158)
3s2eA Crystal structure of furx nadh complex 1
32% identity, 99% coverage: 1:351/356 of query aligns to 3:339/340 of 3s2eA
- active site: C40 (= C38), H41 (= H39), T42 (= T40), H45 (= H43), H63 (= H72), E64 (= E73), C94 (= C102), C97 (= C105), C100 (= C108), C108 (= C116), Q112 (≠ R120), C150 (= C158), T154 (= T162), R333 (= R345)
- binding zinc ion: C40 (= C38), H63 (= H72), E64 (= E73), C94 (= C102), C97 (= C105), C100 (= C108), C108 (= C116), C150 (= C158)
3meqA Crystal structure of alcohol dehydrogenase from brucella melitensis
33% identity, 99% coverage: 1:351/356 of query aligns to 3:341/341 of 3meqA
- active site: C40 (= C38), H41 (= H39), T42 (= T40), H45 (= H43), H63 (= H72), E64 (= E73), C94 (= C102), C97 (= C105), C100 (= C108), C108 (= C116), L112 (≠ R120), C150 (= C158), T154 (= T162), R335 (= R345)
- binding 1,4-dihydronicotinamide adenine dinucleotide: C40 (= C38), H41 (= H39), T42 (= T40), H45 (= H43), C150 (= C158), T154 (= T162), G176 (= G185), G177 (= G186), L178 (≠ V187), D197 (= D207), I198 (≠ V208), K202 (= K212), T241 (≠ D249), A242 (≠ F250), V243 (= V251), S244 (≠ G252), A247 (≠ T256), N264 (≠ C273), G265 (= G274), L266 (= L275), I289 (≠ F298), V290 (= V299)
- binding zinc ion: C40 (= C38), H63 (= H72), C94 (= C102), C97 (= C105), C100 (= C108), C108 (= C116), C150 (= C158)
6n7lC Crystal structure of an alcohol dehydrogenase from elizabethkingia anophelis nuhp1
32% identity, 97% coverage: 6:350/356 of query aligns to 13:342/344 of 6n7lC
- active site: C45 (= C38), T47 (= T40), H50 (= H43), H68 (= H72), C154 (= C158)
- binding nicotinamide-adenine-dinucleotide: C45 (= C38), H46 (= H39), T47 (= T40), H50 (= H43), C154 (= C158), T158 (= T162), G178 (= G183), G180 (= G185), G181 (= G186), L182 (≠ V187), D201 (= D207), V202 (= V208), K206 (= K212), T243 (≠ D249), A244 (≠ F250), V245 (= V251), S246 (≠ G252), A249 (≠ T256), N266 (≠ C273), G267 (= G274), L268 (= L275), I291 (≠ F298), V292 (= V299)
- binding zinc ion: C45 (= C38), H68 (= H72), C98 (= C102), C101 (= C105), C104 (= C108), C112 (= C116), C154 (= C158)
Query Sequence
>H281DRAFT_01171 FitnessBrowser__Burk376:H281DRAFT_01171
MLSYEVTEHGRPLQARLRETPVPKGREVVLRVTHSGLCHTDLHLWHGYFDLGGGRRAPLS
ERGLVPPLTLGHEPLGIVEAVGDAVTGVAPGARCLAFPWIACGACWACDKGRTELCARQR
NLGIGLPGGFATHLVVPDARYLVNVDGIDDAFAATLACSGVTSYAAVSKLPTLEADDHVA
VIGCGGVGLTAISILRARGIERIIACDVSEEKLEAARSLGAAQALRTDSAEAAQALMELA
GNMLGGALDFVGIPSTLDLAYTALRKGGTYVLCGLHGGQATIPIPPIAQRSLSIVGSFVG
SIADLEATVELAKAGKLARLPIQTCDAREINTALSALDAGRVIGRTVIDFTNAEAA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory