Comparing H281DRAFT_01180 FitnessBrowser__Burk376:H281DRAFT_01180 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4x28A Crystal structure of the chse4-chse5 complex from mycobacterium tuberculosis (see paper)
35% identity, 44% coverage: 60:394/762 of query aligns to 49:375/386 of 4x28A
Sites not aligning to the query:
I6YCA3 Acyl-CoA dehydrogenase FadE26; ACAD; 3-oxocholest-4-en-26-oyl-CoA dehydrogenase alpha subunit; EC 1.3.99.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
35% identity, 44% coverage: 60:394/762 of query aligns to 56:388/400 of I6YCA3
P71858 Acyl-CoA dehydrogenase FadE29; ACAD; 3-oxo-23,24-bisnorchol-4-en-22-oyl-CoA dehydrogenase beta subunit; 3-oxo-4-pregnene-20-carboxyl-CoA dehydrogenase beta subunit; EC 1.3.99.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
31% identity, 47% coverage: 40:397/762 of query aligns to 46:378/387 of P71858
P96855 Acyl-CoA dehydrogenase FadE34; ACAD; 3-oxochol-4-en-24-oyl-CoA dehydrogenase; EC 1.3.99.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
33% identity, 45% coverage: 60:399/762 of query aligns to 392:707/711 of P96855
Sites not aligning to the query:
6wy8B Tcur3481-tcur3483 steroid acad (see paper)
33% identity, 35% coverage: 7:276/762 of query aligns to 3:266/384 of 6wy8B
Sites not aligning to the query:
6wy9A Tcur3481-tcur3483 steroid acad g363a variant (see paper)
33% identity, 35% coverage: 9:276/762 of query aligns to 1:262/380 of 6wy9A
Sites not aligning to the query:
2pg0A Crystal structure of acyl-coa dehydrogenase from geobacillus kaustophilus
30% identity, 44% coverage: 12:347/762 of query aligns to 12:340/380 of 2pg0A
Sites not aligning to the query:
1ukwB Crystal structure of medium-chain acyl-coa dehydrogenase from thermus thermophilus hb8
35% identity, 25% coverage: 68:257/762 of query aligns to 57:246/379 of 1ukwB
Sites not aligning to the query:
1ukwA Crystal structure of medium-chain acyl-coa dehydrogenase from thermus thermophilus hb8
35% identity, 25% coverage: 68:257/762 of query aligns to 57:246/379 of 1ukwA
Sites not aligning to the query:
1rx0C Crystal structure of isobutyryl-coa dehydrogenase complexed with substrate/ligand. (see paper)
34% identity, 24% coverage: 59:242/762 of query aligns to 52:234/383 of 1rx0C
Sites not aligning to the query:
1rx0A Crystal structure of isobutyryl-coa dehydrogenase complexed with substrate/ligand. (see paper)
34% identity, 24% coverage: 59:242/762 of query aligns to 53:235/384 of 1rx0A
Sites not aligning to the query:
Q9UKU7 Isobutyryl-CoA dehydrogenase, mitochondrial; IBDH; Activator-recruited cofactor 42 kDa component; ARC42; Acyl-CoA dehydrogenase family member 8; ACAD-8; EC 1.3.8.5 from Homo sapiens (Human) (see 3 papers)
34% identity, 24% coverage: 59:242/762 of query aligns to 84:266/415 of Q9UKU7
Sites not aligning to the query:
4l1fA Electron transferring flavoprotein of acidaminococcus fermentans: towards a mechanism of flavin-based electron bifurcation (see paper)
28% identity, 38% coverage: 57:347/762 of query aligns to 46:339/380 of 4l1fA
Sites not aligning to the query:
5ol2F The electron transferring flavoprotein/butyryl-coa dehydrogenase complex from clostridium difficile (see paper)
25% identity, 46% coverage: 54:400/762 of query aligns to 44:378/378 of 5ol2F
Sites not aligning to the query:
3r7kA Crystal structure of a probable acyl coa dehydrogenase from mycobacterium abscessus atcc 19977 / dsm 44196 (see paper)
37% identity, 24% coverage: 59:242/762 of query aligns to 48:232/378 of 3r7kA
Sites not aligning to the query:
4iv6B X-ray crystal structure of an isovaleryl-coa dehydrogenase from mycobacterium smegmatis (see paper)
27% identity, 40% coverage: 101:402/762 of query aligns to 86:379/383 of 4iv6B
2z1qB Crystal structure of acyl coa dehydrogenase
34% identity, 24% coverage: 57:241/762 of query aligns to 66:248/549 of 2z1qB
Sites not aligning to the query:
8hk0B Crystal structure of fic32-33 complex from streptomyces ficellus nrrl 8067 (see paper)
33% identity, 24% coverage: 57:242/762 of query aligns to 50:233/379 of 8hk0B
Sites not aligning to the query:
1bucA Three-dimensional structure of butyryl-coa dehydrogenase from megasphaera elsdenii (see paper)
28% identity, 32% coverage: 105:347/762 of query aligns to 100:343/383 of 1bucA
Sites not aligning to the query:
Q06319 Acyl-CoA dehydrogenase, short-chain specific; Butyryl-CoA dehydrogenase; BCAD; SCAD; EC 1.3.8.1 from Megasphaera elsdenii (see paper)
28% identity, 32% coverage: 105:347/762 of query aligns to 100:343/383 of Q06319
Sites not aligning to the query:
>H281DRAFT_01180 FitnessBrowser__Burk376:H281DRAFT_01180
MSEVDQVKDEAFYAAFRKKIADYIEANVPADVRAATRANRKLGRDLLSRYTAAMAKGGLG
YSAPGWTKEFGGPGWDVMQRLIFEEVTAAMDCPQLYHHGIGHIGPVIQAFGTDEQKARFL
PPIIDGTEWWCQGYSEPGAGSDLASLKTSAVLDGTGEHYIVNGQKIWTSHAQEADIMYTL
VRTSNEGKRQEGITLLLIPMNTPGIEVRPIRTIDQWHHVNEVFLKDVKVPVSNRIGAEGQ
GWSYGKFLLDRERLSPALMPRLLRHVQQVTQLVQDKIKEKGASPSLLKALDRLLEVEAGA
YGTREILLSAIREDMAGTLESSKSSALKMACSKQSQEVTSIAMDVLGPEYAARLQPLTTS
DDELNLERNFVHTYLFYRSRTLAGGSTEVQKNIIAKTIMEPGYTVANMFCGDMFDSSARL
AAASETLAGNAVEGNASGKWQQALELGWQSVLVSEENGGIGGTLADLASIVEAASRYPNV
APLVERCAVAPVLLEAAAAAPTVSPMLEKLLTGEASVSPVLQSYQGTPLQAATVSLEGNV
LRGSVRGSNESEPATHVVFNASTTEGQALVLIERARLAERARFFGGIDGTVTADYDVDGL
ALNEGEIVLTGPAVNVAVSQALQIGALLTCVQIVGAVGAQVEQTIQYLNDRVQFGKPLAV
HQALRHNVVDCYVAYEGIKGQVARLMESFNGSDDCAIDRLVILTKMFCAGVAKEVGHAVI
QMHGGMGMTVEMPATQLCMQSRTAAERFGNRSQCLDWLVAQT
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory