SitesBLAST
Comparing H281DRAFT_01185 FitnessBrowser__Burk376:H281DRAFT_01185 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q51955 4-hydroxybenzoate transporter PcaK from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 2 papers)
40% identity, 95% coverage: 2:433/453 of query aligns to 10:440/448 of Q51955
- D41 (= D33) mutation D->A,N: Abolishes 4-HBA transport.; mutation to E: Decrease in 4-HBA transport.
- D44 (= D36) mutation D->A,N: Abolishes 4-HBA transport.; mutation to E: Decrease in 4-HBA transport.
- G85 (≠ A77) mutation to V: Abolishes 4-HBA transport and chemotaxis.
- D89 (= D81) mutation to N: Abolishes 4-HBA transport and chemotaxis.
- G92 (= G84) mutation to A: Decrease in 4-HBA transport and chemotaxis.; mutation to C: No change in 4-HBA transport and chemotaxis.; mutation G->L,V: Abolishes 4-HBA transport and chemotaxis.; mutation to Q: Decrease in 4-HBA transport and strong decrease in chemotaxis.
- R124 (= R116) mutation to A: Abolishes 4-HBA transport.
- E144 (= E136) mutation to A: Strong decrease in 4-HBA transport.
- H183 (≠ E175) mutation to A: Decrease in 4-HBA transport and chemotaxis.
- D323 (= D316) mutation to N: Abolishes 4-HBA transport and chemotaxis.
- H328 (≠ V321) mutation to A: Decrease in 4-HBA transport and chemotaxis.; mutation to R: Decrease in 4-HBA transport and loss of chemotaxis.
- R386 (= R379) mutation to A: Strong decrease in 4-HBA transport.
- R398 (= R391) mutation to A: Abolishes 4-HBA transport.
Sites not aligning to the query:
- 444 H→A: No change in 4-HBA transport and chemotaxis.
Q5EXK5 3-hydroxybenzoate transporter MhbT from Klebsiella oxytoca (see paper)
34% identity, 94% coverage: 2:427/453 of query aligns to 3:425/452 of Q5EXK5
- D82 (= D81) mutation to A: Loss of activity.
- V311 (= V313) mutation to W: Loss of activity.
- D314 (= D316) mutation to A: Loss of activity.
P77589 3-(3-hydroxy-phenyl)propionate transporter; 3HPP transporter; 3-(3-hydroxy-phenyl)propionate:H(+) symporter; 3HPP:H(+) symporter from Escherichia coli (strain K12) (see paper)
30% identity, 91% coverage: 25:435/453 of query aligns to 19:393/403 of P77589
- E27 (≠ D33) mutation to A: Lack of 3HPP transport activity.; mutation to D: Slight decrease in 3HPP transport activity.
- D75 (= D81) mutation D->A,E: Lack of 3HPP transport activity.
- A272 (≠ V313) mutation to H: 30% increase in 3HPP transport activity.
- K276 (= K317) mutation to D: Lack of 3HPP transport activity.
Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
25% identity, 81% coverage: 30:395/453 of query aligns to 51:390/444 of Q8NLB7
- D54 (= D33) mutation to A: Loss of transport activity.; mutation to E: Retains 50% of its transport activity.
- D57 (= D36) mutation to A: Loss of transport activity.; mutation to E: Retains 50% of its transport activity.
- R103 (= R82) mutation to A: Loss of transport activity.
- W309 (≠ V313) mutation to V: Loss of transport activity.
- D312 (= D316) mutation to A: Loss of transport activity.
- R313 (≠ K317) mutation to A: Loss of transport activity.
- I317 (≠ V321) mutation I->H,Y: Loss of transport activity.
- R386 (= R391) mutation to A: Loss of transport activity.
Q02563 Synaptic vesicle glycoprotein 2A; Synaptic vesicle protein 2; Synaptic vesicle protein 2A from Rattus norvegicus (Rat) (see 2 papers)
26% identity, 45% coverage: 18:223/453 of query aligns to 164:380/742 of Q02563
- DMCLS 196:200 (≠ QWGVT 50:54) mutation Missing: No change in uptake of C.botulinum neurotoxin type D (BoNT/D, botD) or C.botulinum neurotoxin type E (BoNT/E).
- 321:331 (vs. 175:178, 0% identical) mutation Missing: No change in uptake of BoNT/D or BoNT/E.
Sites not aligning to the query:
- 498 N→Q: No change in uptake of BoNT/E or C.botulinum neurotoxin type A (BoNT/A, botA) by mouse SV2A/SV2B knockout neurons; SV2A apparent molecular weight decreases. No change in uptake of BoNT/E; when associated with Q-548. No change in uptake of BoNT/D.
- 548 N→Q: No change in uptake of BoNT/E or BoNT/A by mouse SV2A/SV2B knockout neurons; SV2A apparent molecular weight decreases. No change in uptake of BoNT/E; when associated with Q-498. No change in uptake of BoNT/D.
- 570:573 RLVN→TLVQ: Restores apparent molecular weight to wild-type, does not restore uptake of BoNT/E.
- 573 N→Q: BoNT/E not taken up by mouse SV2A/SV2B knockout neurons, decreased uptake of BoNT/A; SV2A apparent molecular weight decreases. No change in uptake of BoNT/D.
Q496J9 Synaptic vesicle glycoprotein 2C from Homo sapiens (Human) (see 4 papers)
29% identity, 36% coverage: 63:223/453 of query aligns to 195:366/727 of Q496J9
Sites not aligning to the query:
- 519:563 (Microbial infection) C.botulinum neurotoxin type A-binding
- 534 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 559 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→A: No change in interaction with C.botulinum neurotoxin type A heavy chain (botA, BoNT/A HC). Decreased molecular weight probably due to glycosylation loss, decreased interaction with BoNT/A HC.; N→Q: Decreased molecular weight probably due to glycosylation loss, decreased binding to BoNT/A HC. Greater reduction in weight; when associated with Q-565.
- 561 S→A: Decreased molecular weight probably due to glycosylation loss, decreased binding to BoNT/A HC.
- 563 F→A: No longer interacts with BoNT/A HC.
- 565 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→Q: Decreased molecular weight probably due to glycosylation loss, no change in binding to BoNT/A heavy chain. Greater reduction in weight; when associated with Q-559.
Q9Z2I6 Synaptic vesicle glycoprotein 2C; Synaptic vesicle protein 2C from Rattus norvegicus (Rat) (see 3 papers)
29% identity, 36% coverage: 63:223/453 of query aligns to 195:366/727 of Q9Z2I6
Sites not aligning to the query:
- 1:57 Interaction with SYT1
- 529:566 (Microbial infection) C.botulinum neurotoxin type A-binding
- 559 N→A: Loss of one glycosylation site. No effect on C.botulinum neurotoxin type A (BoNT/A, botA) binding, but reduces the uptake of BoNT/A.
8bvsA Cryo-em structure of rat slc22a6 bound to tenofovir (see paper)
27% identity, 47% coverage: 46:259/453 of query aligns to 101:311/502 of 8bvsA
Sites not aligning to the query:
8bvtA Cryo-em structure of rat slc22a6 bound to probenecid (see paper)
27% identity, 47% coverage: 46:259/453 of query aligns to 110:320/508 of 8bvtA
Sites not aligning to the query:
8bw7A Cryo-em structure of rat slc22a6 bound to alpha-ketoglutaric acid (see paper)
29% identity, 39% coverage: 46:220/453 of query aligns to 101:273/497 of 8bw7A
Sites not aligning to the query:
Q8VC69 Solute carrier family 22 member 6; Kidney-specific transport protein; Novel kidney transcript; mNKT; Organic anion transporter 1; mOAT1; Renal organic anion transporter 1; mROAT1 from Mus musculus (Mouse) (see 2 papers)
29% identity, 39% coverage: 46:220/453 of query aligns to 113:285/545 of Q8VC69
- C122 (≠ K55) mutation to A: Decreased cell surface expression level and PAH transport activity. Complete loss of PAH transport activity; when associated with A-49; A-78; A-99; A-172; A-183; A-200; A-362; A-335; A-379; A-402; A-427 and A-434.
- C183 (≠ M113) mutation to A: Decreased cell surface expression level and PAH transport activity. Complete loss of PAH transport activity; when associated with A-49; A-78; A-99; A-122; A-172; A-200; A-362; A-335; A-379; A-402; A-427 and A-434.
Sites not aligning to the query:
- 39 N→Q: Complete loss of PAH transport activity.
- 49 C→A: Decreased cell surface expression level and PAH transport activity. Complete loss of PAH transport activity; when associated with A-78; A-99; A-122; A-172; A-183; A-200; A-362; A-335; A-379; A-402; A-427 and A-434.
- 56 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 86 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 91 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 107 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 434 C→A: Decreased cell surface expression level and PAH transport activity. 80% decrease of PAH transport activity; when associated with A-49; A-122 and A-183. Complete loss of PAH transport activity; when associated with A-49; A-78; A-99; A-122; A-172; A-183; A-200; A-362; A-335; A-379; A-402 and A-427.
6e9nA E. Coli d-galactonate:proton symporter in the inward open form (see paper)
26% identity, 35% coverage: 24:182/453 of query aligns to 8:166/409 of 6e9nA
Sites not aligning to the query:
P0AA76 D-galactonate transporter; D-galactonate/H(+) symporter from Escherichia coli (strain K12) (see paper)
26% identity, 35% coverage: 24:182/453 of query aligns to 19:177/430 of P0AA76
- Y29 (≠ G34) binding
- D31 (= D36) mutation to N: Loss of galactonate transport activity.
- R32 (≠ T37) binding
- Y64 (≠ I69) binding
- E118 (≠ L123) mutation to Q: Loss of galactonate transport activity.
Sites not aligning to the query:
6e9oA E. Coli d-galactonate:proton symporter mutant e133q in the outward substrate-bound form (see paper)
26% identity, 35% coverage: 24:182/453 of query aligns to 11:169/393 of 6e9oA
Sites not aligning to the query:
A0A0H2VG78 Glucose transporter GlcP; Glucose/H(+) symporter from Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) (see paper)
26% identity, 37% coverage: 61:229/453 of query aligns to 47:229/446 of A0A0H2VG78
- R102 (= R116) mutation to A: Loss of transport activity.
- I105 (≠ T119) mutation to S: Affects symport activity. May function as an uniporter.
- E122 (= E136) mutation to A: Loss of transport activity.
- Q137 (≠ L151) mutation to A: Loss of transport activity.
Sites not aligning to the query:
- 22 D→N: Affects symport activity. May function as an uniporter.
- 250 Q→A: Loss of transport activity.
- 251 Q→A: Loss of transport activity.
- 256 N→A: Loss of transport activity.
- 357 W→A: Loss of transport activity.
P0AGF4 D-xylose-proton symporter; D-xylose transporter from Escherichia coli (strain K12) (see paper)
27% identity, 40% coverage: 42:220/453 of query aligns to 42:243/491 of P0AGF4
- G83 (= G84) mutation to A: Abolishes xylose transport.
- R133 (= R116) mutation R->C,H,L: Abolishes xylose transport.
- E153 (= E136) mutation to A: Abolishes xylose transport.
- R160 (= R143) mutation to A: Abolishes xylose transport.
- Q168 (vs. gap) binding ; mutation to A: Abolishes xylose transport.
Sites not aligning to the query:
- 24 F→A: Decreases xylose transport.
- 288 Q→A: Abolishes xylose transport.
- 288:289 binding
- 289 Q→A: Strongly decreases xylose transport.
- 294 binding ; N→A: Abolishes xylose transport.
- 298 Y→A: Abolishes xylose transport.
- 325 N→A: No effect on xylose transport.
- 340 G→A: Abolishes xylose transport.
- 341 mutation R->A,W: Abolishes xylose transport.
- 392 binding ; W→A: Abolishes xylose transport.
- 397 E→A: Abolishes xylose transport.
- 404 R→A: Strongly decreases xylose transport.
- 415 binding
- 416 W→A: Strongly decreases xylose transport.
4gc0A The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to 6-bromo-6-deoxy-d-glucose (see paper)
27% identity, 40% coverage: 42:220/453 of query aligns to 38:239/475 of 4gc0A
Sites not aligning to the query:
4gbzA The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-glucose (see paper)
27% identity, 40% coverage: 42:220/453 of query aligns to 38:239/475 of 4gbzA
Sites not aligning to the query:
4gbyA The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-xylose (see paper)
27% identity, 40% coverage: 42:220/453 of query aligns to 38:239/475 of 4gbyA
Sites not aligning to the query:
O76082 Organic cation/carnitine transporter 2; High-affinity sodium-dependent carnitine cotransporter; Solute carrier family 22 member 5 from Homo sapiens (Human) (see 21 papers)
25% identity, 83% coverage: 32:408/453 of query aligns to 114:484/557 of O76082
- D115 (= D33) to G: in CDSP; carnitine transport reduced to less than 5% of wild-type; dbSNP:rs386134192
- V123 (≠ L42) to G: in CDSP; carnitine transport reduced to less than 20% of wild-type; dbSNP:rs748605096
- E131 (≠ Q50) to D: in CDSP; uncertain significance; may affect splicing; reduces carnitine transport but the mutant retains 30% of wild-type activity
- A142 (= A59) to S: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains more than 25% of wild-type activity; dbSNP:rs151231558
- P143 (= P60) to L: in CDSP; carnitine transport reduced to less than 2% of wild-type; dbSNP:rs1178584184
- L144 (≠ V61) to F: in dbSNP:rs10040427
- V151 (= V67) to M: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains more than 60% of wild-type activity; dbSNP:rs386134193
- R169 (= R85) to P: in CDSP; loss of carnitine transport; to Q: in CDSP; loss of carnitine transport; dbSNP:rs121908889; to W: in CDSP; loss of carnitine transport; dbSNP:rs121908890
- V175 (≠ T91) to M: in CDSP; carnitine transport reduced to less than 10% of wild-type; dbSNP:rs781721860
- M177 (≠ V93) to V: in CDSP; carnitine transport reduced to less than 20% of wild-type; dbSNP:rs145068530
- M179 (≠ F95) to L: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains more than 40% of wild-type activity; dbSNP:rs386134196
- L186 (≠ A102) to P: in CDSP; loss of carnitine transport; dbSNP:rs386134197
- M205 (≠ L123) to R: in CDSP; loss of carnitine transport; dbSNP:rs796052033
- N210 (≠ P128) to S: in CDSP; loss of carnitine transport; dbSNP:rs386134198
- Y211 (≠ L129) to C: in CDSP; loss of carnitine transport; dbSNP:rs121908888
- A214 (≠ T132) to V: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains 30% of wild-type activity; dbSNP:rs386134199
- T219 (≠ N135) to K: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains 30% of wild-type activity
- S225 (≠ R141) to L: in CDSP; reduces carnitine transport to less than 20% of wild-type activity; dbSNP:rs386134205
- R227 (= R143) to H: in CDSP; reduces carnitine transport to less than 10% of wild-type activity; dbSNP:rs185551386
- F230 (≠ A146) to L: in CDSP; reduces carnitine transport to less than 1% of wild-type activity; dbSNP:rs756650860
- S231 (≠ V147) to F: in CDSP; loss of carnitine transport; dbSNP:rs386134206
- T232 (≠ N148) to M: in CDSP; reduces carnitine transport to less than 20% of wild-type activity; dbSNP:rs114269482
- A240 (≠ V156) to T: in CDSP; reduces carnitine transport to less than 2% of wild-type activity
- G242 (= G158) to V: in CDSP; loss of carnitine transport; dbSNP:rs72552728
- P247 (= P163) to R: in CDSP; loss of carnitine transport
- R254 (≠ H172) to Q: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains more than 30% of wild-type activity; dbSNP:rs200699819
- R257 (≠ E175) to W: in CDSP; reduces carnitine transport to less than 10% of wild-type activity; dbSNP:rs386134203
- T264 (≠ V183) to M: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains more than 40% of wild-type activity; dbSNP:rs201262157; to R: in CDSP; reduces carnitine transport to less than 5% of wild-type activity; dbSNP:rs201262157
- L269 (≠ V188) to P: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains more than 40% of wild-type activity
- S280 (= S199) to F: in CDSP; reduces carnitine transport to less than 1% of wild-type activity; dbSNP:rs386134208
- R282 (= R201) to Q: in CDSP; reduces carnitine transport to 5% of wild-type activity; dbSNP:rs386134210
- W283 (≠ Y202) to C: in CDSP; loss of carnitine transport; dbSNP:rs386134211; to R: in CDSP; reduces carnitine transport to less than 1% of wild-type activity; dbSNP:rs72552729
- A301 (≠ V214) to D: in CDSP; reduces carnitine transport to less-than-1% to 3% of wild-type activity; dbSNP:rs72552730
- I312 (≠ D225) to V: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains 70% of wild-type activity; dbSNP:rs77300588
- E317 (≠ F231) to K: in CDSP; uncertain significance; no effect on carnitine transport; dbSNP:rs774792831
- I348 (≠ W262) to T: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains 60% of wild-type activity; dbSNP:rs150544263
- W351 (≠ Y265) to R: in CDSP; loss of carnitine transport; dbSNP:rs68018207
- M352 (≠ I266) mutation to R: Loss of both carnitine and organic cation transport functionalities. No effect on protein expression.
- S355 (≠ T269) to L: in CDSP; reduces carnitine transport to less than 2% of wild-type activity; dbSNP:rs1385634398
- Y358 (≠ L272) to N: in CDSP; loss of carnitine transport; dbSNP:rs61731073
- L363 (≠ M277) to P: in CDSP; loss of carnitine transport; dbSNP:rs386134214
- L394 (≠ M315) natural variant: Missing (in CDSP; reduces carnitine transport to 5% of wild-type activity)
- P398 (≠ G319) to L: in CDSP; reduces carnitine transport to less than 1% of wild-type activity; dbSNP:rs144547521
- R399 (≠ P320) to Q: in CDSP; carnitine transport is reduced to less than 1% of normal; dbSNP:rs121908891; to W: in CDSP; reduces carnitine transport to less than 5% of wild-type activity; dbSNP:rs267607054
- S412 (= S333) to G: in CDSP; uncertain significance; no effect on carnitine transport
- V439 (≠ N360) to G: in CDSP; reduces carnitine transport to less than 1% of wild-type activity
- T440 (≠ G361) to M: in CDSP; loss of carnitine transport; dbSNP:rs72552732
- A442 (≠ C363) to I: in CDSP; reduces carnitine transport to less than 20% of wild-type activity; requires 2 nucleotide substitutions; dbSNP:rs267607053
- F443 (≠ S364) to V: in CDSP; reduces carnitine transport to less than 1% of wild-type
- V446 (≠ S367) to F: in CDSP; reduces carnitine transport to less than 1% of wild-type; dbSNP:rs72552733
- Y447 (≠ T368) to C: in CDSP; loss of carnitine transport; dbSNP:rs386134218
- V448 (≠ L369) to L: in CDSP; reduces carnitine transport to less than 20% of wild-type; dbSNP:rs386134219
- Y449 (≠ A370) to D: in CDSP; uncertain significance; reduces carnitine transport to less than 20% of wild-type; dbSNP:rs11568514
- E452 (≠ Q372) to K: in CDSP; reduces carnitine transport to less than 5% of wild-type; dbSNP:rs72552734
- P455 (= P375) to R: in CDSP; loss of carnitine transport; dbSNP:rs1408166345
- G462 (= G382) to V: in CDSP; reduces carnitine transport to less than 5% of wild-type
- S467 (≠ R391) to C: in CDSP; reduces carnitine transport to less than 20% of wild-type activity; dbSNP:rs60376624
- T468 (≠ F392) to R: in CDSP; markedly reduced carnitine transport compared to the wild-type protein; less than 1% of wild-type activity; dbSNP:rs386134221
- S470 (≠ G394) to F: in CDSP; loss of carnitine transport; dbSNP:rs386134222
- R471 (≠ I395) to H: in CDSP; reduces carnitine transport to less than 2% of wild-type; dbSNP:rs386134223; to P: in CDSP; loss of carnitine transport
- L476 (= L400) to R: in CDSP; loss of carnitine transport
- P478 (= P402) to L: in CDSP; loss of carnitine transport but stimulated organic cation transport; no effect on protein expression; dbSNP:rs72552735
- V481 (≠ I405) to F: reduces carnitine transport but the mutant retains more than 60% of wild-type activity; dbSNP:rs11568513; to I: in dbSNP:rs11568513
Sites not aligning to the query:
- 12 G → S: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains 50% of wild-type activity; dbSNP:rs139203363
- 15 G → W: in CDSP; carnitine transport reduced to less than 20% of wild-type; dbSNP:rs267607052
- 16 P → L: in CDSP; loss of carnitine transport
- 17 F → L: in CDSP; carnitine transport reduced to less than 20% of wild-type; dbSNP:rs11568520
- 19 R → P: in CDSP; carnitine transport is reduced to less than 5% of normal; dbSNP:rs72552723
- 20 L → H: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains 50% of wild-type activity; dbSNP:rs144020613
- 22 natural variant: Missing (in CDSP; reduces carnitine transport to less than 1% of normal)
- 26 S → N: in CDSP; carnitine transport reduced to less than 6% of wild-type; dbSNP:rs772578415
- 28 S → I: in CDSP; carnitine transport reduced to 1% of wild-type; dbSNP:rs72552724
- 32 N → S: in CDSP; carnitine transport reduced to less than 1% of wild-type; dbSNP:rs72552725
- 44 A → V: in CDSP; carnitine transport reduced to less than 10% of wild-type; dbSNP:rs199689597
- 46 P → L: in CDSP; carnitine transport reduced to less than 5% of wild-type; dbSNP:rs377767445; P → S: in CDSP; carnitine transport is reduced to less than 5% of normal; dbSNP:rs202088921
- 50 C → Y: in CDSP; loss of carnitine transport
- 57 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 66 T → P: in CDSP; carnitine transport reduced to 2% of wild-type
- 75 R → P: in CDSP; carnitine transport reduced to 2% of wild-type; dbSNP:rs757711838
- 83 R → L: in CDSP; loss of carnitine transport; dbSNP:rs72552726
- 91 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→Q: Reduces expression to 50%. No effect on carnitine transporter activity.
- 93 S → W: in CDSP; loss of carnitine transport; dbSNP:rs386134190
- 95 L → V: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains 30% of wild-type activity; dbSNP:rs386134191
- 96 G → A: in CDSP; carnitine transport reduced to 20% of wild-type; dbSNP:rs377767450
- 488 R → C: in CDSP; reduces carnitine transport to less than 10% of wild-type; dbSNP:rs377216516; R → H: in CDSP; uncertain significance; reduces carnitine transport to 40% of wild-type; dbSNP:rs28383481
- 507 L → S: in CDSP; reduces carnitine transport to 5% of wild-type; dbSNP:rs1157198543
- 508 F → L: in dbSNP:rs11568521
- 530 M → V: in dbSNP:rs11568524
- 549 P → S: reduces carnitine transport but the mutant retains more than 20% of wild-type activity; dbSNP:rs11568525
Query Sequence
>H281DRAFT_01185 FitnessBrowser__Burk376:H281DRAFT_01185
MKTIDVKSFIDQRPLKPFHAILFMLMFLTIVLDGLDTSAMGLIAPTLMKQWGVTKSDLAP
VLSAALVGIGIGAIFGAPLADRIGRRVVLVTSVAFFGVFSIAAGCSTNVTELMWSRLLTG
VGLGAAIPLCATLVNEFLPSRMRSRAVNFMLFGFAVGGGITGPLAKSVIPTHGWEGYLIV
GGVAPIVVAVLLAFFLPESVRYLAAAGKGQDKIVKALKRIDPTADFTDTTFVAEVSAAVQ
KRKFPVSELFSARLRWPTMLLWVAYICSTITLYVLSMWLPTILQGDGRTLAQTANTMMWF
NWCSGAAILLAGVLMDKFGPVRVISAYFAISMSMALLVSISGAHGDALLTLLVIAAMTNN
GACSSMSTLATQMYPTSSRATGAAWVLGVGRFGGIAGTFLGPVMIGLGWPLTTIVAWIAL
PAVIASVSIFCIGFRIPALRRGYVGLPSGEAVH
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory