Comparing H281DRAFT_01223 FitnessBrowser__Burk376:H281DRAFT_01223 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
44% identity, 96% coverage: 11:500/509 of query aligns to 5:494/501 of P04983
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
26% identity, 42% coverage: 18:229/509 of query aligns to 12:232/253 of 1g9xB
5x40A Structure of a cbio dimer bound with amppcp (see paper)
34% identity, 47% coverage: 21:259/509 of query aligns to 16:242/280 of 5x40A
Sites not aligning to the query:
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
29% identity, 42% coverage: 18:229/509 of query aligns to 9:218/240 of 4ymuJ
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
26% identity, 42% coverage: 18:229/509 of query aligns to 12:232/254 of 1g6hA
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
27% identity, 45% coverage: 9:236/509 of query aligns to 1:225/241 of 4u00A
1oxvD Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
28% identity, 46% coverage: 10:245/509 of query aligns to 3:242/353 of 1oxvD
1oxvA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
28% identity, 46% coverage: 10:245/509 of query aligns to 3:242/353 of 1oxvA
1oxuA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
28% identity, 46% coverage: 10:245/509 of query aligns to 3:242/353 of 1oxuA
Q97UY8 Glucose import ATP-binding protein GlcV; EC 7.5.2.- from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
28% identity, 46% coverage: 10:245/509 of query aligns to 3:242/353 of Q97UY8
7o12B Abc transporter nosdfy, amppnp-bound in gdn (see paper)
31% identity, 45% coverage: 11:238/509 of query aligns to 3:218/298 of 7o12B
3c4jA Abc protein artp in complex with atp-gamma-s
26% identity, 46% coverage: 11:243/509 of query aligns to 4:241/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
26% identity, 46% coverage: 11:243/509 of query aligns to 4:241/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
26% identity, 46% coverage: 11:243/509 of query aligns to 4:241/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
26% identity, 46% coverage: 11:243/509 of query aligns to 4:241/242 of 2oljA
4f4cA The crystal structure of the multi-drug transporter (see paper)
36% identity, 36% coverage: 30:210/509 of query aligns to 1043:1223/1250 of 4f4cA
Sites not aligning to the query:
7o17B Abc transporter nosdfy e154q, atp-bound in lipid nanodisc (see paper)
30% identity, 45% coverage: 11:238/509 of query aligns to 3:218/298 of 7o17B
3fvqB Crystal structure of the nucleotide binding domain fbpc complexed with atp (see paper)
32% identity, 42% coverage: 11:223/509 of query aligns to 4:214/350 of 3fvqB
Q5M244 Energy-coupling factor transporter ATP-binding protein EcfA2; ECF transporter A component EcfA2; EC 3.6.3.- from Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) (see paper)
29% identity, 41% coverage: 24:234/509 of query aligns to 21:232/280 of Q5M244
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
33% identity, 43% coverage: 9:226/509 of query aligns to 3:222/648 of P75831
>H281DRAFT_01223 FitnessBrowser__Burk376:H281DRAFT_01223
VQQPTSAVPRLELRHASKSFGRVRALSDGDLSLWPGEVHALLGENGAGKSTLVKILAGVH
QPDSGELLVDGVARRFATPAQARDAGLAVIYQEPTLFFDLSIAENIFMGRQPVDRFGRIQ
YDAMRREVDGLLASLGVDLRADQLVRGLSIADQQVIEIAKALSLNANVLIMDEPTAALSL
TEVERLFAIVRKLRERDVAILFITHRLDEVFALTQRVTIMRDGAKVFDGMTADLNTDAIV
SKMVGRDLETFYPKAERPPGEARLSVRGLTRVGVFKDISFDVRAGEIVALAGLVGAGRSE
VARAIFGIDPLDAGQIQIGGKPLADGSPAAAVRAGLALVPEDRRQQGLALELSIARNASM
TVLGRLVRHGLITTRSETQLANQWGTRLRLKAGDPNAPVGMLSGGNQQKVVLGKWLATNP
KVLIIDEPTRGIDVGAKAEVYSALAELVRDGMAVLMISSELPEVLGMADRVLVMHEGRIS
ADIARAEADEERIMAAALGQPIPPLGNAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory