Comparing H281DRAFT_01297 FitnessBrowser__Burk376:H281DRAFT_01297 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 2 hits to proteins with known functional sites (download)
Q02I31 Putative pterin-4-alpha-carbinolamine dehydratase; PHS; 4-alpha-hydroxy-tetrahydropterin dehydratase; Pterin carbinolamine dehydratase; PCD; EC 4.2.1.96 from Pseudomonas aeruginosa (strain UCBPP-PA14) (see paper)
34% identity, 64% coverage: 9:94/135 of query aligns to 20:108/118 of Q02I31
Sites not aligning to the query:
2v6tB Crystal structure of a complex of pterin-4a-carbinolamine dehydratase from toxoplasma gondii with 7,8-dihydrobiopterin (see paper)
36% identity, 53% coverage: 24:94/135 of query aligns to 21:93/100 of 2v6tB
>H281DRAFT_01297 FitnessBrowser__Burk376:H281DRAFT_01297
MAKTEKTYTDEEIQQRLVGPLQHWYVEDGWLRRKYRTEGWKGTLMVVNAVGHLAEAAWHH
PDLTVSYAFVIVKLKTHSAKGITDKDFALANKIESFIQWQPATEGGPLEGTPSDDQRFRY
IKYDAAKAEGAAEGG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory