SitesBLAST
Comparing H281DRAFT_01363 FitnessBrowser__Burk376:H281DRAFT_01363 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5e9sA Crystal structure of substrate-bound glutamate transporter homologue glttk (see paper)
31% identity, 94% coverage: 18:422/433 of query aligns to 11:423/427 of 5e9sA
- binding aspartic acid: R274 (≠ S280), S275 (= S281), S276 (= S282), T313 (= T318), G353 (= G358), V354 (= V359), A357 (= A362), G358 (≠ A363), D394 (≠ G393), R397 (≠ L396), T398 (≠ A397)
- binding decyl-beta-d-maltopyranoside: L194 (≠ G200), G198 (≠ I204), Y202 (≠ V208)
- binding sodium ion: Y87 (≠ F94), T90 (≠ V97), S91 (= S98), S276 (= S282), G305 (= G310), A306 (≠ Y311), T307 (≠ S312), N309 (= N314), N309 (= N314), M310 (≠ L315), D311 (= D316), S348 (= S353), I349 (≠ K354), G350 (= G355), T351 (≠ A356), N401 (= N400), V402 (≠ T401), D405 (≠ N404)
6xwnB Structure of glutamate transporter homologue glttk in the presence of tboa inhibitor (see paper)
31% identity, 94% coverage: 18:422/433 of query aligns to 11:423/426 of 6xwnB
6zgbA Glutamate transporter homologue glttk in complex with a photo cage compound (see paper)
31% identity, 94% coverage: 18:422/433 of query aligns to 9:421/425 of 6zgbA
6zl4A The structure of glutamate transporter homologue glttk in complex with the photo switchable compound (cis) (see paper)
31% identity, 94% coverage: 18:422/433 of query aligns to 8:420/424 of 6zl4A
- binding decyl-beta-d-maltopyranoside: L191 (≠ G200), G195 (≠ I204), R282 (≠ L290)
- binding (2~{S},3~{S})-2-azanyl-3-[[4-[2-(4-methoxyphenyl)hydrazinyl]phenyl]methoxy]butanedioic acid: R271 (≠ S280), S272 (= S281), S273 (= S282), M307 (≠ L315), T310 (= T318), G353 (= G361), A354 (= A362), R394 (≠ L396), T395 (≠ A397)
Sites not aligning to the query:
6r7rA Crystal structure of the glutamate transporter homologue glttk in complex with d-aspartate (see paper)
31% identity, 94% coverage: 18:422/433 of query aligns to 4:412/416 of 6r7rA
- binding d-aspartic acid: R263 (≠ S280), S265 (= S282), M299 (≠ L315), T302 (= T318), T340 (≠ A356), G342 (= G358), V343 (= V359), G347 (≠ A363), D383 (≠ G393), R386 (≠ L396), T387 (≠ A397), N390 (= N400)
- binding decyl-beta-d-maltopyranoside: H23 (= H38), V212 (= V229), A216 (≠ L233)
O59010 Glutamate transporter homolog; Glt(Ph); Sodium-aspartate symporter Glt(Ph); Sodium-dependent aspartate transporter from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 3 papers)
31% identity, 90% coverage: 31:420/433 of query aligns to 25:421/425 of O59010
- S65 (≠ T69) mutation to V: Strongly decreased chloride conductance.
- R276 (≠ S280) mutation to S: Increased rate of aspartate transport; when associated with R-395.
- RSS 276:278 (≠ SSS 280:282) binding
- M311 (≠ L315) mutation to A: Decreased dependence of aspartate binding on Na(+) concentration.
- T314 (= T318) binding
- V355 (= V359) binding
- D394 (≠ G393) binding
- M395 (≠ T394) mutation to R: Increased rate of aspartate transport; when associated with S-276.
- R397 (≠ L396) mutation to A: Strongly decreased affinity for aspartate.
- N401 (= N400) binding
- D405 (≠ N404) mutation to N: Strongly decreased affinity for aspartate.
2nwwA Crystal structure of gltph in complex with tboa (see paper)
30% identity, 89% coverage: 31:415/433 of query aligns to 16:407/407 of 2nwwA
6bauA Crystal structure of gltph r397c in complex with l-cysteine (see paper)
29% identity, 93% coverage: 15:415/433 of query aligns to 1:408/408 of 6bauA
- binding cysteine: S270 (= S282), M303 (≠ L315), T306 (= T318), A345 (≠ S357), G346 (= G358), V347 (= V359), G351 (≠ A363), D386 (≠ G393), C389 (≠ L396), T390 (≠ A397), N393 (= N400)
6bavA Crystal structure of gltph r397c in complex with s-benzyl-l-cysteine (see paper)
29% identity, 93% coverage: 15:415/433 of query aligns to 1:408/409 of 6bavA
6x14A Inward-facing state of the glutamate transporter homologue gltph in complex with tfb-tboa (see paper)
30% identity, 89% coverage: 31:415/433 of query aligns to 22:413/413 of 6x14A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: G66 (= G73), V83 (≠ L91), I157 (≠ L172), Y164 (vs. gap), K193 (≠ G200), T305 (≠ S312), I306 (≠ F313), I347 (≠ K354)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: M199 (= M206), S275 (= S282), T311 (= T318), G356 (≠ A363), L384 (= L386), D391 (≠ G393), R394 (≠ L396)
Sites not aligning to the query:
6x15A Inward-facing state of the glutamate transporter homologue gltph in complex with l-aspartate and sodium ions (see paper)
30% identity, 90% coverage: 31:418/433 of query aligns to 25:419/419 of 6x15A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: F46 (≠ L50), F46 (≠ L50), P75 (≠ D79), L91 (≠ I96), F95 (≠ L100), L130 (vs. gap), I133 (≠ F145), I159 (≠ V171), Y167 (vs. gap), K196 (≠ G200), G200 (≠ I204), I207 (= I211), F210 (= F214), L250 (≠ I254), I262 (≠ M266), M269 (≠ I273), T334 (≠ S338), V335 (≠ L339), G336 (≠ T340), T340 (= T344), L343 (≠ G347), M399 (≠ I398)
- binding aspartic acid: S277 (= S281), S278 (= S282), T314 (= T318), G354 (= G358), A358 (= A362), G359 (≠ A363), D394 (≠ G393), R397 (≠ L396), T398 (≠ A397)
- binding sodium ion: Y89 (≠ F94), T92 (≠ V97), S93 (= S98), G306 (= G310), T308 (≠ S312), N310 (= N314), N310 (= N314), M311 (≠ L315), D312 (= D316), S349 (= S353), I350 (≠ K354), T352 (≠ A356), N401 (= N400), V402 (≠ T401), D405 (≠ N404)
Sites not aligning to the query:
6bmiA Crystal structure of gltph r397c in complex with l-serine (see paper)
29% identity, 89% coverage: 31:415/433 of query aligns to 17:396/396 of 6bmiA
7awmA Structure of the thermostabilized eaat1 cryst mutant in complex with l-asp, three sodium ions and the allosteric inhibitor ucph101 (see paper)
28% identity, 86% coverage: 51:424/433 of query aligns to 57:407/412 of 7awmA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: S88 (≠ V83), G89 (= G84), G92 (= G87), A95 (= A90), V96 (≠ L91), Y99 (≠ F94), M163 (≠ V171), F167 (≠ A175), F293 (≠ L305), V297 (≠ A309)
- binding aspartic acid: S268 (= S281), S269 (= S282), T306 (= T318), G346 (= G358), I347 (≠ V359), A350 (= A362), G351 (≠ A363), D380 (≠ G393), R383 (≠ L396), T384 (≠ A397)
5mjuA Structure of the thermostabilized eaat1 cryst mutant in complex with the competititve inhibitor tfb-tboa and the allosteric inhibitor ucph101 (see paper)
28% identity, 86% coverage: 51:424/433 of query aligns to 49:393/397 of 5mjuA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: L72 (≠ I74), S80 (≠ V83), G81 (= G84), G84 (= G87), Y91 (≠ F94), M156 (≠ V171), F160 (≠ A175), F286 (≠ L305), V290 (≠ A309)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I64 (= I66), I148 (≠ V163), S262 (= S282), S263 (≠ E283), A292 (≠ Y311), T293 (≠ S312), M296 (≠ L315), T299 (= T318), G329 (= G355), A336 (= A362), G337 (≠ A363), D366 (≠ G393), R369 (≠ L396), N373 (= N400)
P43003 Excitatory amino acid transporter 1; Sodium-dependent glutamate/aspartate transporter 1; GLAST-1; Solute carrier family 1 member 3 from Homo sapiens (Human) (see 3 papers)
25% identity, 99% coverage: 1:428/433 of query aligns to 28:512/542 of P43003
- S363 (= S280) mutation to R: Loss of electrogenic glutamate transport. Strongly decreased L-aspartate and L-glutamate uptake combined with strongly increased permeability ot other ions; when associated with M-477.
- SSS 363:365 (= SSS 280:282) binding
- T396 (≠ S312) binding
- T402 (= T318) binding
- IPQAG 443:447 (≠ VAGAA 359:363) binding
- D476 (≠ G393) binding
- R477 (≠ T394) mutation to M: Strongly decreased L-aspartate and L-glutamate uptake combined with strongly increased permeability ot other ions; when associated with R-363.
- N483 (= N400) binding
Sites not aligning to the query:
- 523 Y→F: No effect on activity.
P56564 Excitatory amino acid transporter 1; Glial high affinity glutamate transporter; High-affinity neuronal glutamate transporter; GluT-1; Sodium-dependent glutamate/aspartate transporter 1; GLAST-1; Solute carrier family 1 member 3 from Mus musculus (Mouse) (see paper)
25% identity, 99% coverage: 1:428/433 of query aligns to 28:512/543 of P56564
- N206 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N216 (≠ T142) modified: carbohydrate, N-linked (GlcNAc...) asparagine
7xr6A Structure of human excitatory amino acid transporter 2 (eaat2) in complex with way-213613 (see paper)
26% identity, 86% coverage: 51:424/433 of query aligns to 47:419/424 of 7xr6A
- binding (2S)-2-azanyl-4-[[4-[2-bromanyl-4,5-bis(fluoranyl)phenoxy]phenyl]amino]-4-oxidanylidene-butanoic acid: S280 (= S281), S281 (= S282), T318 (= T318), G363 (≠ A363), M367 (≠ L367), V385 (≠ L386), D388 (≠ H389), R395 (≠ L396), T396 (≠ A397)
- binding dodecyl beta-D-glucopyranoside: W389 (≠ R390)
- binding cholesterol hemisuccinate: R80 (= R85), R84 (≠ K89), I95 (≠ L100), I252 (≠ L258)
Sites not aligning to the query:
P31596 Excitatory amino acid transporter 2; GLT-1; Sodium-dependent glutamate/aspartate transporter 2; GLUT-R; Solute carrier family 1 member 2 from Rattus norvegicus (Rat) (see paper)
25% identity, 88% coverage: 51:431/433 of query aligns to 82:508/573 of P31596
- K298 (= K207) mutation K->H,R: Normal transporter activity.; mutation K->N,T: Reduced transporter activity.
- H326 (≠ I236) mutation H->N,T,K,R: No transporter activity.
P43006 Excitatory amino acid transporter 2; GLT-1; Sodium-dependent glutamate/aspartate transporter 2; Solute carrier family 1 member 2 from Mus musculus (Mouse) (see paper)
25% identity, 88% coverage: 51:431/433 of query aligns to 82:508/572 of P43006
Sites not aligning to the query:
- 38 modified: S-palmitoyl cysteine; C→S: Severely impairs glutamate uptake activity.
O35874 Neutral amino acid transporter A; Alanine/serine/cysteine/threonine transporter 1; ASCT-1; Solute carrier family 1 member 4 from Mus musculus (Mouse) (see 2 papers)
26% identity, 87% coverage: 51:425/433 of query aligns to 79:496/532 of O35874
- N201 (≠ Q139) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N206 (≠ E144) modified: carbohydrate, N-linked (GlcNAc...) asparagine
Query Sequence
>H281DRAFT_01363 FitnessBrowser__Burk376:H281DRAFT_01363
MSESAVMTSSAPGAKKPFYRTLYFHVFAAIIIGVLLGHFAPSLAVKMKPLGDAFIKLIKM
VIGPIIFCTVVTGIAGMGDMKKVGRVGGKALLYFEIVSTLSLVIGLVAGHIFHPGSGFNL
DPATIDTKALAGYTTAAHQQNTVEFLMHIIPDTVTGAFASGNVLQILLISVLFGAALAAT
GERGRPLIAMIDYFAHTFFGIVHIIMKVAAIGAFGSIAFTIGTYGIGAVVPLLKLIGAFY
ATLAVFVIVVLGAISRLLGFSIFRFMSYIREEILIVLGTSSSEAALPQMLEKLERLGCSK
SVVGLVIPAGYSFNLDGTNIYLTMAVLFIAQAFNIELSLTQQLTLVGVAMLTSKGASGVA
GAAFVMLTSTLLVFPLIPVSGMVLILGIHRFMGTGLAIANTIGNGVATLVVSAWEHELDR
SKLNAGMSRRRAD
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory