Comparing H281DRAFT_01373 FitnessBrowser__Burk376:H281DRAFT_01373 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
3wr9A Crystal structure of the anaerobic desb-gallate complex (see paper)
54% identity, 99% coverage: 2:278/281 of query aligns to 1:276/416 of 3wr9A
Sites not aligning to the query:
3wkuA Crystal structure of the anaerobic desb-gallate complex (see paper)
54% identity, 99% coverage: 2:278/281 of query aligns to 1:271/407 of 3wkuA
Sites not aligning to the query:
1b4uB Protocatechuate 4,5-dioxygenase (ligab) in complex with protocatechuate (pca) (see paper)
46% identity, 99% coverage: 2:278/281 of query aligns to 1:280/298 of 1b4uB
P0ABR9 2,3-dihydroxyphenylpropionate/2,3-dihydroxicinnamic acid 1,2-dioxygenase; 3-carboxyethylcatechol 2,3-dioxygenase; EC 1.13.11.16 from Escherichia coli (strain K12) (see paper)
32% identity, 65% coverage: 11:194/281 of query aligns to 9:180/314 of P0ABR9
Sites not aligning to the query:
>H281DRAFT_01373 FitnessBrowser__Burk376:H281DRAFT_01373
MARIIGGIGTSHVPTIGMAYDKGKQNDPAWAPLFKGYEPVANWLAERKPDAMVMFYNDHA
NSFFFDCYPTFALGVSGNHEFADEGAGKRPLPDIAGHPDLAIHIAEQLVNDEFDLTIFQD
RPLDHGCNSPLSLMLPHAGGWPLALVPVQVNVLQYPLPTANRCYRLGQALRRAIESFEED
LDVVVVGTGGLSHQVHGERSGFNNTEWDMEFLDLIVHEPQRLAAMKHVDYVRLGGAESVE
TIMWLAMRGALGPKIRELHRNYYLATSTAMAVTIYEDEVAQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory