Comparing H281DRAFT_01376 FitnessBrowser__Burk376:H281DRAFT_01376 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 7 hits to proteins with known functional sites (download)
6p3hC Crystal structure of ligu(k66m) bound to substrate (see paper)
66% identity, 95% coverage: 10:357/368 of query aligns to 6:349/352 of 6p3hC
6p3jB Crystal structure of ligu (see paper)
65% identity, 96% coverage: 4:357/368 of query aligns to 5:346/352 of 6p3jB
Sites not aligning to the query:
Q8EJW4 2-methyl-aconitate isomerase; Cis-trans isomerase; EC 5.3.3.- from Shewanella oneidensis (strain MR-1) (see paper)
36% identity, 96% coverage: 6:360/368 of query aligns to 9:395/397 of Q8EJW4
5k87A Crystal structure of malonate bound to methylaconitate isomerase prpf from shewanella oneidensis (see paper)
36% identity, 96% coverage: 6:360/368 of query aligns to 5:387/389 of 5k87A
2pw0A Crystal structure of trans-aconitate bound to methylaconitate isomerase prpf from shewanella oneidensis (see paper)
36% identity, 96% coverage: 6:360/368 of query aligns to 4:383/385 of 2pw0A
2pvzA Crystal structure of methylaconitate isomerase prpf from shewanella oneidensis (see paper)
36% identity, 96% coverage: 6:360/368 of query aligns to 5:385/387 of 2pvzA
2pw0B Crystal structure of trans-aconitate bound to methylaconitate isomerase prpf from shewanella oneidensis (see paper)
37% identity, 96% coverage: 6:360/368 of query aligns to 5:339/341 of 2pw0B
>H281DRAFT_01376 FitnessBrowser__Burk376:H281DRAFT_01376
MPSRTQTRIPCMMIRGGTSKGAFFMASDLPAEPAERDRVLLAVMGSPDPRQIDGIGGADP
LTSKVAIISPSSREDADVDYLFAQVVVNEARVDFGQNCGNILAGVGPYAIERGLVNAEDG
STRVAIHMVNTGQIAVATVRTPGCRVTYEGDARIDGVPGGAAPIPLEFRDTAGSTCGALL
PTGRLKDTVEGVELTCIDNGMPLVLMRARDLQRTGYETREELDADNELKARIEKIRLVVG
PMMNLGDVSARTVPKMCLVAEPRNGGTISTRSFIPHRCHASIGVLGAVSVATAAVLPGTV
CDGIAKVELEGARKRVSVEHPTGEFTVELTLGGEPERPEVLSAALLRTARWLFDGVVGIP
SSVWEPQV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory