Comparing H281DRAFT_01452 FitnessBrowser__Burk376:H281DRAFT_01452 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
P94530 Arabinooligosaccharides transport system permease protein AraQ from Bacillus subtilis (strain 168) (see paper)
25% identity, 94% coverage: 20:305/305 of query aligns to 3:281/281 of P94530
P68183 Maltose/maltodextrin transport system permease protein MalG from Escherichia coli (strain K12) (see 2 papers)
27% identity, 68% coverage: 99:305/305 of query aligns to 86:296/296 of P68183
7cagA Mycobacterium smegmatis lpqy-sugabc complex in the catalytic intermediate state (see paper)
37% identity, 24% coverage: 159:230/305 of query aligns to 142:216/285 of 7cagA
Sites not aligning to the query:
>H281DRAFT_01452 FitnessBrowser__Burk376:H281DRAFT_01452
MNTLSSPLKSAAPHSASKRRRRTAFTPARVGVYLFLLSAALFFLLPLYVMLVTSFKPMSE
IRLGNLLALPAHFTLHAWSAAWESACTGLDCNGIQVGFWNSVRIVVPSTVFSIAIGAVNG
YALSFWRPRGAGVLFGVLLMGAFIPVQVMVYPLVRVLASVHLFSSLPGIVVIHTIFGMPV
MTLLFRNYYASIPQELFKAARIDGGGFWRIFVQLMLPMSTPIIVVAVIMQVTGIWNDFIL
GLVFAGTKNLPMTVQLNNIINTTTGERLYNVNMAATILTSLVPLAVYFISGRWFVRGIAS
GAVKG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory