Comparing H281DRAFT_01453 FitnessBrowser__Burk376:H281DRAFT_01453 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
7cagA Mycobacterium smegmatis lpqy-sugabc complex in the catalytic intermediate state (see paper)
28% identity, 85% coverage: 29:299/319 of query aligns to 4:268/285 of 7cagA
P94529 Arabinooligosaccharides transport system permease protein AraP from Bacillus subtilis (strain 168) (see paper)
27% identity, 63% coverage: 35:236/319 of query aligns to 31:231/313 of P94529
4ki0F Crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to maltohexaose (see paper)
22% identity, 65% coverage: 97:304/319 of query aligns to 270:490/490 of 4ki0F
P02916 Maltose/maltodextrin transport system permease protein MalF from Escherichia coli (strain K12) (see 4 papers)
22% identity, 65% coverage: 97:304/319 of query aligns to 285:505/514 of P02916
>H281DRAFT_01453 FitnessBrowser__Burk376:H281DRAFT_01453
MHALKLHASRPGSASGSGSPKKPFKKPLKKRFSIAAWLALLPMILTVVFAYLGTMVWTAR
VSLSNSRTFPSGDFAGLTQYVRLFNNARWLLSLQNIVIYGACFIVACMVIGLLLAIFIDQ
RVVAEGALRTVFLYPYAMSFVATGLVWQWILNPELGAQAVLHKLGFVHARFDWIVDQDWA
IYTIVIATVWQASGLVMALLLAGLRGIDDELWKAARIDGIPRWRVYASIVVPMLGPSIST
AFVLLFVMVVKLYDAVVAMTQGGPGTASEVPAKFIMDYLFGRANIGLASAASIVLLATVL
AILTPFFYARSRAALRKEV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory