SitesBLAST
Comparing H281DRAFT_01455 FitnessBrowser__Burk376:H281DRAFT_01455 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6z1mA Structure of an ancestral glycosidase (family 1) bound to heme (see paper)
52% identity, 93% coverage: 26:455/464 of query aligns to 5:419/423 of 6z1mA
- binding protoporphyrin ix containing fe: P164 (= P184), N165 (≠ W185), L194 (= L214), L195 (= L215), L218 (≠ A238), L220 (≠ I240), N244 (= N264), F247 (≠ I267), K253 (= K273), Y256 (= Y276), L288 (= L303), R318 (≠ G352), Y323 (≠ S358)
- binding magnesium ion: H346 (≠ N382), K409 (≠ R445)
4ptwA Halothermothrix orenii beta-glucosidase a, 2-deoxy-2-fluoro-glucose complex (see paper)
47% identity, 94% coverage: 23:456/464 of query aligns to 2:442/445 of 4ptwA
- active site: R74 (= R95), H118 (= H138), E163 (= E183), V166 (≠ C186), N291 (= N309), Y293 (= Y311), E351 (= E367)
- binding 2-deoxy-2-fluoro-alpha-D-glucopyranose: Q17 (= Q38), H118 (= H138), E163 (= E183), Y293 (= Y311), E351 (= E367), W398 (= W413), E405 (= E420), W406 (= W421)
4ptvA Halothermothrix orenii beta-glucosidase a, thiocellobiose complex (see paper)
47% identity, 94% coverage: 23:456/464 of query aligns to 2:442/445 of 4ptvA
- active site: R74 (= R95), H118 (= H138), E163 (= E183), V166 (≠ C186), N291 (= N309), Y293 (= Y311), E351 (= E367)
- binding beta-D-glucopyranose: W324 (= W339), E405 (= E420), Y408 (≠ F423)
- binding 4-thio-beta-D-glucopyranose: Q17 (= Q38), H118 (= H138), E163 (= E183), Y293 (= Y311), E351 (= E367), W398 (= W413), E405 (= E420), W406 (= W421)
5ns8A Crystal structure of beta-glucosidase bglm-g1 mutant h75r from marine metagenome in complex with inhibitor 1-deoxynojirimycin (see paper)
49% identity, 93% coverage: 24:456/464 of query aligns to 5:439/440 of 5ns8A
7wdoA Crystal structures of mebgld2 in complex with various saccharides
49% identity, 92% coverage: 27:452/464 of query aligns to 8:437/445 of 7wdoA
- binding beta-D-glucopyranose: Q19 (= Q38), H120 (= H138), W121 (= W139), N164 (= N182), E165 (= E183), E165 (= E183), N222 (= N239), N224 (≠ G241), Y294 (= Y311), E351 (= E367), W398 (= W413), E405 (= E420), W406 (= W421), F414 (= F429)
7wdsA Crystal structures of mebgld2 in complex with various saccharides
49% identity, 92% coverage: 27:452/464 of query aligns to 8:437/444 of 7wdsA
- binding beta-D-xylopyranose: Q19 (= Q38), H120 (= H138), E165 (= E183), L172 (= L190), Y294 (= Y311), W324 (= W339), E351 (= E367), W398 (= W413), E405 (= E420), W406 (= W421), R408 (≠ F423)
7wdnA Crystal structures of mebgld2 in complex with various saccharides (see paper)
49% identity, 92% coverage: 27:452/464 of query aligns to 8:437/444 of 7wdnA
- binding alpha-D-glucopyranose: Q19 (= Q38), E25 (≠ D44), D35 (= D54), H120 (= H138), E165 (= E183), E165 (= E183), K186 (≠ G204), N222 (= N239), F246 (≠ H263), W266 (= W284), Y267 (≠ P285), Y294 (= Y311), P306 (≠ G323), M307 (≠ F324), W324 (= W339), E351 (= E367), W398 (= W413), E405 (= E420), W406 (= W421), F414 (= F429)
7wdrA Crystal structures of mebgld2 in complex with various saccharides
48% identity, 92% coverage: 27:452/464 of query aligns to 8:437/445 of 7wdrA
- binding 4-nitrophenyl beta-D-glucopyranoside: Q19 (= Q38), H120 (= H138), E165 (= E183), W167 (= W185), N222 (= N239), L223 (≠ I240), N224 (≠ G241), F246 (≠ H263), Y294 (= Y311), A295 (≠ F312), R296 (= R313), T297 (= T314), F312 (≠ L329), W324 (= W339), W324 (= W339), E325 (= E340), W398 (= W413), E405 (= E420), W406 (= W421)
6m6lB The crystal structure of glycosidase hydrolyzing notoginsenoside
48% identity, 94% coverage: 25:459/464 of query aligns to 7:445/445 of 6m6lB
4hz7A Crystal structure of bglb with glucose (see paper)
48% identity, 91% coverage: 26:448/464 of query aligns to 5:429/441 of 4hz7A
- active site: R74 (= R95), H118 (= H138), E163 (= E183), V166 (≠ C186), N290 (= N309), Y292 (= Y311), E347 (= E367)
- binding beta-D-glucopyranose: Q17 (= Q38), H118 (= H138), E163 (= E183), Y292 (= Y311), E347 (= E367), W394 (= W413), E401 (= E420), W402 (= W421), F410 (= F429)
2o9rA Beta-glucosidase b complexed with thiocellobiose (see paper)
44% identity, 94% coverage: 20:454/464 of query aligns to 1:440/445 of 2o9rA
- active site: R76 (= R95), H119 (= H138), E164 (= E183), C167 (= C186), N293 (= N309), Y295 (= Y311), E353 (= E367)
- binding beta-D-glucopyranose: E164 (= E183), Y295 (= Y311), W325 (= W339), E353 (= E367), W399 (= W413), E406 (= E420)
2jieA Beta-glucosidase b from bacillus polymyxa complexed with 2-f-glucose (see paper)
44% identity, 94% coverage: 20:454/464 of query aligns to 1:440/445 of 2jieA
- active site: R76 (= R95), H119 (= H138), E164 (= E183), C167 (= C186), N293 (= N309), Y295 (= Y311), E353 (= E367)
- binding 2-deoxy-2-fluoro-alpha-D-glucopyranose: Q19 (= Q38), H119 (= H138), N163 (= N182), E164 (= E183), Y295 (= Y311), E353 (= E367), W399 (= W413), E406 (= E420), F415 (= F429)
6r4kA Structure of beta-glucosidase a from paenibacillus polymyxa complexed with a monovalent inhibitor (see paper)
47% identity, 91% coverage: 26:446/464 of query aligns to 8:431/448 of 6r4kA
- binding (2~{S},3~{S},4~{R})-2-[[4-[4-[2-[2-(2-azanylidenehydrazinyl)ethoxy]ethoxy]phenyl]-1,2,3-triazol-1-yl]methyl]pyrrolidine-3,4-diol: Q20 (= Q38), H121 (= H138), E166 (= E183), L173 (= L190), E352 (= E367), W398 (= W413), E405 (= E420), W406 (= W421)
6qwiA Structure of beta-glucosidase a from paenibacillus polymyxa complexed with multivalent inhibitors. (see paper)
47% identity, 91% coverage: 26:446/464 of query aligns to 8:431/448 of 6qwiA
- binding (2~{S},3~{S},4~{R})-2-[[4-[4-(2-ethoxyethoxy)phenyl]-1,2,3-triazol-1-yl]methyl]pyrrolidine-3,4-diol: Q20 (= Q38), H121 (= H138), W122 (= W139), E166 (= E183), L173 (= L190), W326 (= W339), E352 (= E367), W398 (= W413), E405 (= E420), W406 (= W421)
1e4iA 2-deoxy-2-fluoro-beta-d-glucosyl/enzyme intermediate complex of the beta-glucosidase from bacillus polymyxa (see paper)
46% identity, 91% coverage: 26:446/464 of query aligns to 7:430/447 of 1e4iA
- active site: R76 (= R95), H120 (= H138), E165 (= E183), C168 (= C186), N293 (= N309), Y295 (= Y311), E351 (= E367)
- binding 2-deoxy-2-fluoro-alpha-D-glucopyranose: Q19 (= Q38), H120 (= H138), N164 (= N182), E165 (= E183), Y295 (= Y311), E351 (= E367), W397 (= W413), E404 (= E420), W405 (= W421)
- binding 2,4-dinitrophenyl 2-deoxy-2-fluoro-beta-D-glucopyranoside: R136 (= R154), Q140 (≠ Y158), V143 (≠ A161), L202 (= L220)
1bggB Glucosidase a from bacillus polymyxa complexed with gluconate (see paper)
46% identity, 91% coverage: 26:446/464 of query aligns to 7:430/447 of 1bggB
- active site: R76 (= R95), H120 (= H138), E165 (= E183), C168 (= C186), N293 (= N309), Y295 (= Y311), E351 (= E367)
- binding D-gluconic acid: Q19 (= Q38), H120 (= H138), W121 (= W139), N164 (= N182), E165 (= E183), Y295 (= Y311), E351 (= E367), W397 (= W413), E404 (= E420), W405 (= W421)
8ivyA Beta-glucosidase bgla mutant e166q in complex with glucose (see paper)
44% identity, 93% coverage: 26:455/464 of query aligns to 8:444/451 of 8ivyA
1gnxA B-glucosidase from streptomyces sp
50% identity, 92% coverage: 26:452/464 of query aligns to 6:439/447 of 1gnxA
- active site: R75 (= R95), H119 (= H138), E164 (= E183), C167 (= C186), N293 (= N309), Y295 (= Y311), E353 (= E367)
- binding beta-D-fructofuranose: Q285 (≠ A301), K286 (≠ P302)
- binding alpha-D-glucopyranose: Q204 (≠ P223), R281 (≠ Q297), Q285 (≠ A301)
- binding sulfate ion: R190 (≠ Q209), F274 (≠ L290), R276 (≠ L292)
6rjmB Complex structure of virulence factor sgha and its hydrolysis product glucose (see paper)
46% identity, 93% coverage: 21:451/464 of query aligns to 7:442/456 of 6rjmB
- binding alpha-D-glucopyranose: Q24 (= Q38), H125 (= H138), N169 (= N182), E170 (= E183), Y298 (= Y311), W331 (= W339), E358 (= E367), W404 (= W413), E411 (= E420), W412 (= W421), F420 (= F429)
2cesA Beta-glucosidase from thermotoga maritima in complex with glucoimidazole (see paper)
47% identity, 92% coverage: 28:455/464 of query aligns to 8:435/440 of 2cesA
- active site: R75 (= R95), H119 (= H138), E164 (= E183), V167 (≠ C186), N291 (= N309), Y293 (= Y311), E346 (= E367)
- binding glucoimidazole: Q18 (= Q38), H119 (= H138), N163 (= N182), E164 (= E183), Y293 (= Y311), E346 (= E367), W393 (= W413), E400 (= E420), W401 (= W421), F409 (= F429)
Query Sequence
>H281DRAFT_01455 FitnessBrowser__Burk376:H281DRAFT_01455
VAHDALSSHSSADPFTPAADSALWRKNFLLGAATASYQIEGAVDEDGRLPSIWDTFCATP
GKVLAGDSGAVACDHYHRWESDVDMLVGLGLEGYRLSIAWPRVMDANGASNRKGLDFYKR
LLTRLKEKGITTFVTLYHWDLPQHLEDRGGWLNRETAYRFADYADLMSRELAGTVDAWAT
LNEPWCSAYLGYGNGHHAPGLANGRFATQAMHHLLLAHGLALPVLRENDPSSQKGIVANI
GRGTPNSDSVEDQRAAQLFEIQHNAWILDPLLKGAYPEALFELWPGTEPLILGGDMQIIS
APLDFLGINYYFRTNVATDGAHGFTEVPLEGVERTQMGWEVYPDGLRDLLIGFSHEYSNL
PPVYITENGMASDDTVIDGRVNDTQRISFLKRHLAAVDEAIKAGVDIRGYFLWSLMDNFE
WAFGYERRFGIVHVDYVTQKRTTKRSAELVSQFIEERKERSQRA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory