Comparing H281DRAFT_01475 FitnessBrowser__Burk376:H281DRAFT_01475 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8gy3C Cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans
32% identity, 92% coverage: 49:732/740 of query aligns to 7:718/732 of 8gy3C
5y6qC Crystal structure of an aldehyde oxidase from methylobacillus sp. Ky4400 (see paper)
24% identity, 43% coverage: 279:598/740 of query aligns to 110:420/748 of 5y6qC
Sites not aligning to the query:
P77489 Aldehyde oxidoreductase molybdenum-binding subunit PaoC; EC 1.2.99.6 from Escherichia coli (strain K12) (see 2 papers)
25% identity, 61% coverage: 198:649/740 of query aligns to 5:485/732 of P77489
Sites not aligning to the query:
5g5gC Escherichia coli periplasmic aldehyde oxidase (see paper)
25% identity, 61% coverage: 198:649/740 of query aligns to 5:485/731 of 5g5gC
Sites not aligning to the query:
O33819 4-hydroxybenzoyl-CoA reductase subunit alpha; 4-HBCR subunit alpha; EC 1.1.7.1 from Thauera aromatica (see paper)
36% identity, 19% coverage: 593:732/740 of query aligns to 609:753/769 of O33819
Sites not aligning to the query:
1rm6A Structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica (see paper)
36% identity, 19% coverage: 593:732/740 of query aligns to 601:745/761 of 1rm6A
Sites not aligning to the query:
3hrdB Crystal structure of nicotinate dehydrogenase (see paper)
35% identity, 17% coverage: 607:732/740 of query aligns to 183:316/330 of 3hrdB
Sites not aligning to the query:
Q0QLF1 Nicotinate dehydrogenase medium molybdopterin subunit; NDH; Nicotinic acid hydroxylase medium molybdopterin subunit; NAH; EC 1.17.1.5 from Eubacterium barkeri (Clostridium barkeri) (see paper)
35% identity, 17% coverage: 607:732/740 of query aligns to 183:316/330 of Q0QLF1
Sites not aligning to the query:
3hrdE Crystal structure of nicotinate dehydrogenase (see paper)
27% identity, 49% coverage: 205:569/740 of query aligns to 2:386/420 of 3hrdE
3hrdA Crystal structure of nicotinate dehydrogenase (see paper)
27% identity, 49% coverage: 205:569/740 of query aligns to 2:386/420 of 3hrdA
Q0QLF2 Nicotinate dehydrogenase large molybdopterin subunit; NDH; Nicotinic acid hydroxylase large molybdopterin subunit; NAH; EC 1.17.1.5 from Eubacterium barkeri (Clostridium barkeri) (see 2 papers)
27% identity, 49% coverage: 205:569/740 of query aligns to 3:387/425 of Q0QLF2
Sites not aligning to the query:
1t3qB Crystal structure of quinoline 2-oxidoreductase from pseudomonas putida 86 (see paper)
22% identity, 50% coverage: 197:563/740 of query aligns to 5:402/786 of 1t3qB
Sites not aligning to the query:
4zohA Crystal structure of glyceraldehyde oxidoreductase (see paper)
32% identity, 16% coverage: 611:731/740 of query aligns to 567:694/701 of 4zohA
Sites not aligning to the query:
7dqxD Crystal structure of xanthine dehydrogenase family protein
23% identity, 49% coverage: 210:569/740 of query aligns to 6:401/770 of 7dqxD
Sites not aligning to the query:
3zyvB Crystal structure of the mouse liver aldehyde oxidase 3 (maox3) (see paper)
26% identity, 44% coverage: 225:551/740 of query aligns to 542:880/1262 of 3zyvB
Sites not aligning to the query:
8emtB Cryo-em analysis of the human aldehyde oxidase from liver (see paper)
24% identity, 42% coverage: 251:562/740 of query aligns to 530:836/1221 of 8emtB
Sites not aligning to the query:
G3X982 Aldehyde oxidase 3; Aldehyde oxidase homolog 1; Azaheterocycle hydroxylase 3; EC 1.2.3.1; EC 1.17.3.- from Mus musculus (Mouse) (see paper)
24% identity, 50% coverage: 225:591/740 of query aligns to 595:970/1335 of G3X982
Sites not aligning to the query:
P19913 Carbon monoxide dehydrogenase large chain; CO dehydrogenase subunit L; CO-DH L; EC 1.2.5.3 from Hydrogenophaga pseudoflava (Pseudomonas carboxydoflava) (see paper)
22% identity, 34% coverage: 225:478/740 of query aligns to 33:333/803 of P19913
Sites not aligning to the query:
1ffvB Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava (see paper)
22% identity, 34% coverage: 225:478/740 of query aligns to 27:327/797 of 1ffvB
Sites not aligning to the query:
1ffuB Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor (see paper)
22% identity, 34% coverage: 225:478/740 of query aligns to 27:327/797 of 1ffuB
Sites not aligning to the query:
>H281DRAFT_01475 FitnessBrowser__Burk376:H281DRAFT_01475
MTTGSDLTDAVRPSRRTFLKAAGAVAAVGANIGLTIGFEWAGMGRRALAATMPDATFAPN
AFLRVAPDNSVTVIAKHVEMGQGAYTGIATIVAEELDANWQDVRVESAPADAKRYANLAF
GTMQGTGGSSAMANSWMQLREAGAKARAMLVSAAAAQWQVPATELVTRDGSVHHAATNRS
ATYGSLASAAARLPVPQKVALKSPKDFRLIGHQLPRVDVPPKTDGTAQFTLDVTFPGMLV
ALLQRPPLFGATVKSFDASAAKAVPGVVSVVQVPGGVAVVAKGFWAAKQGRDALKVEWDD
SKAEKRSSDAIMAEYRRLAEQPGATARKDGNAEQALSGAAKKISASYSFPYLAHAPMEPL
DAVVKLTANSCEIWAGDQFQTVDQANAARTAGLDPQQVKIYTLYAGGSFGRRANTRSDYI
VEAVSIARALGANGTPVKLQWTREDDIHGGLYRPMYFHKLDAGLTADGKLVGWRHRIVGQ
SILGDTPFASVMVKNGIDATSVEGAANLAYAIPNISVELTTTQTGVPVLWWRVVGSSHTA
FAVEAFIDEAAHAAGKDPFAFRRDLLAHEPRMRAVLELAAQKAGWDPAKPLPKGRGRGIA
VAEAFKTFVAQVAEVSVDQDGNVKVERVVCAVDCGTPINPDVIAAQMEGGIGFGLGAALH
SAITLKDGKVEQNNFDSYQVLRIAEMPKVEVHIVQSGEAPTGVGEPGVAPVGPAVANAIF
AATGKRLYDLPFPAAAGKTD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory