Comparing H281DRAFT_01480 FitnessBrowser__Burk376:H281DRAFT_01480 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9X1K9 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
33% identity, 97% coverage: 3:293/299 of query aligns to 1:284/294 of Q9X1K9
1o5kA Crystal structure of dihydrodipicolinate synthase (tm1521) from thermotoga maritima at 1.80 a resolution
33% identity, 97% coverage: 3:293/299 of query aligns to 2:285/295 of 1o5kA
4dxvA Crystal structure of dihydrodipicolinate synthase from acinetobacter baumannii complexed with mg and cl ions at 1.80 a resolution
33% identity, 97% coverage: 4:293/299 of query aligns to 2:281/291 of 4dxvA
3u8gA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with oxalic acid at 1.80 a resolution
33% identity, 97% coverage: 4:293/299 of query aligns to 2:281/291 of 3u8gA
3tdfA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 2-ketobutanoic acid at 1.99 a resolution
33% identity, 97% coverage: 4:293/299 of query aligns to 2:281/291 of 3tdfA
3tceA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 5-hydroxylysine at 2.6 a resolution
33% identity, 97% coverage: 4:293/299 of query aligns to 2:281/291 of 3tceA
3rk8A Crystal structure of the chloride inhibited dihydrodipicolinate synthase from acinetobacter baumannii complexed with pyruvate at 1.8 a resolution
33% identity, 97% coverage: 4:293/299 of query aligns to 2:281/291 of 3rk8A
3pueB Crystal structure of the complex of dhydrodipicolinate synthase from acinetobacter baumannii with lysine at 2.6a resolution
33% identity, 97% coverage: 4:293/299 of query aligns to 2:281/291 of 3pueB
2atsA Dihydrodipicolinate synthase co-crystallised with (s)-lysine
34% identity, 94% coverage: 3:283/299 of query aligns to 1:272/292 of 2atsA
P0A6L2 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Escherichia coli (strain K12) (see 7 papers)
34% identity, 94% coverage: 3:283/299 of query aligns to 1:272/292 of P0A6L2
5t25A Kinetic, spectral and structural characterization of the slow binding inhibitor acetopyruvate with dihydrodipicolinate synthase from escherichia coli.
34% identity, 94% coverage: 3:283/299 of query aligns to 2:273/293 of 5t25A
3i7sA Dihydrodipicolinate synthase mutant - k161a - with the substrate pyruvate bound in the active site. (see paper)
34% identity, 94% coverage: 3:283/299 of query aligns to 1:272/292 of 3i7sA
Q5HG25 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Staphylococcus aureus (strain COL) (see paper)
31% identity, 94% coverage: 3:282/299 of query aligns to 4:271/295 of Q5HG25
4fhaA Structure of dihydrodipicolinate synthase from streptococcus pneumoniae,bound to pyruvate and lysine
32% identity, 96% coverage: 7:293/299 of query aligns to 10:286/307 of 4fhaA
3di1B Crystal structure of the staphylococcus aureus dihydrodipicolinate synthase-pyruvate complex (see paper)
31% identity, 94% coverage: 3:282/299 of query aligns to 4:271/291 of 3di1B
Q07607 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; Protein MosA; EC 4.3.3.7 from Rhizobium meliloti (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
32% identity, 97% coverage: 3:293/299 of query aligns to 1:281/292 of Q07607
7kg2A Dihydrodipicolinate synthase (dhdps) from c.Jejuni, h59k mutant with pyruvate bound in the active site and l-histidine bound at the allosteric site
30% identity, 99% coverage: 2:297/299 of query aligns to 2:285/296 of 7kg2A
6u01B Dihydrodipicolinate synthase (dhdps) from c.Jejuni, n84d mutant with pyruvate bound in the active site (see paper)
30% identity, 99% coverage: 2:297/299 of query aligns to 2:285/296 of 6u01B
4m19A Dihydrodipicolinate synthase from c. Jejuni with pyruvate bound to the active site and lysine bound to allosteric site (see paper)
30% identity, 99% coverage: 2:297/299 of query aligns to 2:285/296 of 4m19A
7kkdB Dihydrodipicolinate synthase (dhdps) from c.Jejuni, n84a mutant with pyruvate bound in the active site and r,r-bislysine bound at the allosteric site
30% identity, 99% coverage: 2:297/299 of query aligns to 12:295/306 of 7kkdB
>H281DRAFT_01480 FitnessBrowser__Burk376:H281DRAFT_01480
MSIFSGIWVPLITPFADAAVDHAAVRALVRRYADAGIAGIVALGTTGEPAALSAAEQDAV
LATILDAAQAGGARADASTDSKPALPVVVGVSGNNTQSMRERIAQLNSLPVAGVLMAAPY
YIRPSQAGIVGHFMALADASEKPVVLYDIPYRTGVRLELDTLMTLAAHPRIQAVKDCAGS
LDTTLALIRDGRLQVLAGEDMQMFNTMCLGGSGAIAASAHVQPERFVALYRALAAGALEE
ARRIFHALAPLIDTLFAEPNPAPVKAMLASQGLIRDELRLPMTRASEKLVERLAALETA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory