Comparing H281DRAFT_01513 FitnessBrowser__Burk376:H281DRAFT_01513 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 10 hits to proteins with known functional sites (download)
O04373 IAA-amino acid hydrolase ILR1-like 4; jasmonoyl-L-amino acid hydrolase; EC 3.5.1.-; EC 3.5.1.127 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
39% identity, 94% coverage: 23:394/396 of query aligns to 51:423/440 of O04373
P54955 N-acetylcysteine deacetylase; S-(2-succino)cysteine metabolism operon protein P; EC 3.5.1.- from Bacillus subtilis (strain 168)
38% identity, 93% coverage: 20:389/396 of query aligns to 10:371/380 of P54955
P54968 IAA-amino acid hydrolase ILR1; EC 3.5.1.- from Arabidopsis thaliana (Mouse-ear cress) (see paper)
37% identity, 95% coverage: 18:394/396 of query aligns to 50:427/442 of P54968
6slfA Nalpha-acylglutamine aminoacylase from corynebacterium sp.Releasing human axilla odorants co-crystallised with high affinity inhibitor (see paper)
40% identity, 85% coverage: 9:345/396 of query aligns to 7:344/398 of 6slfA
Sites not aligning to the query:
4ewtA The crystal structure of a putative aminohydrolase from methicillin resistant staphylococcus aureus (see paper)
34% identity, 94% coverage: 22:395/396 of query aligns to 18:389/389 of 4ewtA
3rzaA Crystal structure of a tripeptidase (sav1512) from staphylococcus aureus subsp. Aureus mu50 at 2.10 a resolution
28% identity, 66% coverage: 83:345/396 of query aligns to 85:327/373 of 3rzaA
Sites not aligning to the query:
3ramA Crystal structure of hmra (see paper)
30% identity, 40% coverage: 19:176/396 of query aligns to 17:160/391 of 3ramA
Sites not aligning to the query:
P44514 Succinyl-diaminopimelate desuccinylase; SDAP desuccinylase; N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase; EC 3.5.1.18 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 3 papers)
23% identity, 45% coverage: 115:291/396 of query aligns to 108:283/377 of P44514
Sites not aligning to the query:
5vo3A Crystal structure of dape in complex with the products (succinic acid and diaminopimelic acid) (see paper)
23% identity, 45% coverage: 115:291/396 of query aligns to 112:287/380 of 5vo3A
Sites not aligning to the query:
7t1qA Crystal structure of the succinyl-diaminopimelate desuccinylase (dape) from acinetobacter baumannii in complex with succinic acid
27% identity, 52% coverage: 102:306/396 of query aligns to 91:295/377 of 7t1qA
Sites not aligning to the query:
>H281DRAFT_01513 FitnessBrowser__Burk376:H281DRAFT_01513
MSESARYTEVADLIPAAESLREIRHHIHHHPELAYEELQTGALVAGKLEEWGWQVTRGVG
QTGVVGTLKVGDGKRSIGIRADMDALPIIEQTGLPYASGTHGKMHACGHDGHTTILLGAA
QRLAATRNFSGTVHLYFQPAEESGIDSGAKKMIEDGLFERFPCDAVFGLHNHPGAEPGVL
LFRKGPFMSAGDKAIITVEGVGGHAARPHLTVDPVVVAASIVMALQTIVARNVDPSQPAV
VTVGSMHAGTANNVIASTARLELSVRSFSPEVRALLKKRITELAQTQAASYGGKAVVEYI
EGYPVVVNSDDETDFAVEVARELVGNDRVVAQTDILMGSEDFAFMLQKRPGTFLRIGNGV
GEDGCMVHNPHYDFNDQNLPVGAAFWTRLVERYLSR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory